KEGG   Ehrlichia canis: Ecaj_0672Help
Entry
Ecaj_0672         CDS       T00270                                 

Definition
(GenBank) aspartyl-tRNA synthetase
  KO
K01876  aspartyl-tRNA synthetase [EC:6.1.1.12]
Organism
ecn  Ehrlichia canis
Pathway
ecn00970  Aminoacyl-tRNA biosynthesis
Brite
KEGG Orthology (KO) [BR:ecn00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    Ecaj_0672
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:ecn01007]
    Ecaj_0672
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:ecn03016]
    Ecaj_0672
   03029 Mitochondrial biogenesis [BR:ecn03029]
    Ecaj_0672
Enzymes [BR:ecn01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.12  aspartate---tRNA ligase
     Ecaj_0672
Amino acid related enzymes [BR:ecn01007]
 Aminoacyl-tRNA synthetase
  Class II (A)
   Ecaj_0672
Transfer RNA biogenesis [BR:ecn03016]
 Eukaryotic Type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    Ecaj_0672
 Prokaryotic Type
   Other AARSs
    Ecaj_0672
Mitochondrial biogenesis [BR:ecn03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    Ecaj_0672
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_2 GAD tRNA_anti-codon eIF-3_zeta
Motif
Other DBs
NCBI-ProteinID: AAZ68704
UniProt: Q3YRF1
Position
946659..948431
Genome map
AA seq 590 aa AA seqDB search
MNIYRTHLCNELREEHINQEVILSGWVYRKRDHGKIIFVDLRDHYGITQLVFNEADNEIF
QLISYLKLESVITIKGTVVARDSSTINTTVSTGLIEVVVNHVTIESEANLLPMNIASTQE
YPEDIRFKYRFLDLRRDKVKHNIILRSKVIAELRKSMENMGFIEIQTPILTSSSPEGARD
YLVPSRIHHGKFYALPQAPQLFKQILMVSGFDKYFQIAPCFRDEDARADRSPGEFYQLDM
EMSFVTQEDVFNVIEPVLLNIFSKFSSKTIHKEFPRISYHNAMLYYGSDKPDLRNPLIIQ
DVTEIFRDSQFNIFNSNIKKGMVVRAIPAPKTANNPRSFFDNKIEFAKTLGAQGLGYITF
NDDSSAKGPIAKFLDEERLNKIKSICNLQTGDSVFFVSETEDKAAEFAGEIRTILGTELN
LIEPDTFRFCWVVDFPYFKYDKKEKSIGFFHNPFSMPQGGLEALNNQDPLSILAYQYDIV
CNGIEISSGAIRNHKLDIMYKAFSIAGYTQEMVDKKFNSLTRAFKFGAPPHGGIAPGIDR
MVMLLADATNIREVICFPLNQSGEDLLMGAPSEIDTEHLKLLSLNITKKS
NT seq 1773 nt NT seq  +upstreamnt  +downstreamnt
atgaacatatacagaacacacctgtgcaatgaactaagggaagaacatattaaccaagaa
gtaattctttctggatgggtatatagaaaacgtgatcacggaaaaattatttttgtagat
ttacgcgatcactatggaataacacaattagtatttaacgaagctgataatgaaattttt
caactaatctcttatctaaaattagaaagcgtaattacaataaaaggtacagtagtagcc
agggatagttctactatcaatactacagtcagtactggattaattgaagttgtagtaaat
catgtcacaattgagtcagaagcaaacctcctaccaatgaatatagcatcaactcaagaa
tatccagaagatataagattcaagtataggttcctagatctaaggcgtgacaaagtaaaa
cataatataatcttaagatctaaagtcattgcagaactaagaaaaagcatggaaaatatg
ggtttcattgaaatacaaactcctattttgacatcatcatctccagaaggagctagagat
tatttagtaccaagtcgtatacaccatggaaaattttatgctttacctcaagctcctcag
ttatttaaacagatattaatggtaagtggattcgataaatattttcaaatagcaccttgc
tttagagatgaggatgcaagagcagaccgctcacctggagaattctatcagttagatatg
gaaatgtcttttgttacacaagaagacgtattcaatgttattgaaccagtactactcaat
atattcagtaaattttcaagtaaaactattcacaaagaatttccaagaatatcataccac
aatgcaatgctatattatggatcagacaaaccagatctgagaaacccattaataattcaa
gatgtcacagaaattttcagagattcacaattcaatatctttaactcaaacatcaaaaaa
ggaatggtagtaagagcaataccggcacctaaaacagcaaataatcctcgcagctttttt
gataataaaattgaatttgcaaaaacgttaggagcacaaggattagggtatattaccttc
aacgatgattcttctgctaaaggacctatagctaaatttttagacgaagagaggttaaat
aaaattaagtctatctgtaatttacagactggagatagtgtattttttgtatcagaaaca
gaagacaaagccgcagaatttgcaggagaaataagaacaatattgggaacagagctcaat
ctaattgagccagatacctttagattttgttgggttgtagattttccatatttcaagtac
gacaaaaaagaaaaatctattggattctttcataatcctttttcaatgccacaaggaggt
ttagaagctctaaataaccaagatccattaagtatactcgcataccagtatgacatagta
tgtaacggtatagaaatttccagtggagcaatacgtaaccacaaactggatattatgtat
aaggcattttcaatagcaggttatactcaagaaatggtagataaaaaattcaactctctt
acacgtgctttcaaatttggagcaccaccacatggagggattgctccagggatagatcgt
atggtaatgctattagcagatgcaacaaacattagagaagttatctgcttcccacttaat
caatctggtgaagatttacttatgggcgctccatcagaaatagacacagaacatttaaaa
ttgttatcactaaacattacaaaaaaatcttaa

DBGET integrated database retrieval system