KEGG   Ehrlichia canis: Ecaj_0829Help
Entry
Ecaj_0829         CDS       T00270                                 

Definition
(GenBank) protein of unknown function DUF525
  KO
K06195  ApaG protein
Organism
ecn  Ehrlichia canis
Brite
KEGG Orthology (KO) [BR:ecn00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99994 Others
    Ecaj_0829
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF525
Motif
Other DBs
NCBI-ProteinID: AAZ68860
UniProt: Q3YQZ5
Position
complement(1163034..1163438)
Genome map
AA seq 134 aa AA seqDB search
MTLQYYSMTKLIEVKVVPSYLEEQSAPHENCYIWLYNIRVKNRSNSTVQLLRRSWKIIDS
TGIINEVTGLGVIGKQPILKPGEFFEYTSGAYLSTPSGMMHGEYQFMDEDAAQVFYVNIP
VFSLDSPYVNTKPH
NT seq 405 nt NT seq  +upstreamnt  +downstreamnt
atgacgttgcaatattacagcatgactaagcttattgaagttaaagtcgttccaagttac
ttagaagaacagtctgctccacatgagaattgttatatctggttatataacattagggtt
aaaaatagaagtaattctacagtacagctcttgagaagaagttggaaaatcattgattca
actggtattattaatgaagttacaggtcttggtgtgatagggaagcagcctattttgaag
cctggagagttctttgagtatactagtggtgcatatttaagtactccatctgggatgatg
catggagagtatcaatttatggatgaggatgcagctcaggttttctatgttaatataccg
gtgttttcactagatagtccttatgttaatacaaaaccgcattag

DBGET integrated database retrieval system