KEGG   Ehrlichia canis: Ecaj_0840
Entry
Ecaj_0840         CDS       T00270                                 

Definition
(GenBank) conserved hypothetical protein
Organism
ecn  Ehrlichia canis
SSDB
Motif
Pfam: TrbC
Other DBs
NCBI-ProteinID: AAZ68871
UniProt: Q3YQY4
Position
complement(1187439..1187801)
AA seq 120 aa
MLKIIVMFFTIVGFISVTPLAFANSSSDTTGAQDEVSKVICNVILFVQKLGLPIMTGVIL
GSSIMAIFGKLPWPAIVMLVVFTAIFFGAGKLVSKFVAGVNNNLTSGSDCTSGSTPEKAK
NT seq 363 nt   +upstreamnt  +downstreamnt
atgttaaaaataattgttatgttttttaccattgttgggtttattagtgttacaccattg
gcttttgcaaatagcagcagtgatactactggtgctcaagatgaagtaagtaaggttata
tgtaatgttatattgtttgtacaaaaattaggtttaccaattatgactggtgtaatactt
ggctcaagtattatggcaatatttggaaaattaccttggccagcaatagtaatgttagtt
gtatttacagcgatattttttggagctggtaaattggtaagtaagtttgtagctggggtt
aataacaatttaaccagtggatcagattgtacttcaggttcaactccagagaaagcaaaa
tga

DBGET integrated database retrieval system