KEGG   Escherichia coli K-12 MG1655: b0570
Entry
b0570             CDS       T00007                                 
Symbol
cusS
Name
(RefSeq) sensor histidine kinase CusS
  KO
K07644  two-component system, OmpR family, heavy metal sensor histidine kinase CusS [EC:2.7.13.3]
Organism
eco  Escherichia coli K-12 MG1655
Pathway
eco02020  Two-component system
Brite
KEGG Orthology (KO) [BR:eco00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    b0570 (cusS)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:eco01001]
    b0570 (cusS)
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:eco02022]
    b0570 (cusS)
   01504 Antimicrobial resistance genes [BR:eco01504]
    b0570 (cusS)
Enzymes [BR:eco01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.13  Protein-histidine kinases
    2.7.13.3  histidine kinase
     b0570 (cusS)
Protein kinases [BR:eco01001]
 Histidine kinases
  OmpR family
   b0570 (cusS)
Two-component system [BR:eco02022]
 OmpR family
  CusS-CusR (copper tolerance)
   b0570 (cusS)
Antimicrobial resistance genes [BR:eco01504]
 Gene sets
  beta-Lactam resistance modules
   Imipenem resistance, repression of porin OprD [MD:M00745]
    b0570 (cusS)
SSDB
Motif
Pfam: HATPase_c HisKA HAMP HATPase_c_5 HATPase_c_2 DUF5337
Other DBs
NCBI-GeneID: 945978
NCBI-ProteinID: NP_415102
Pasteur: ybcZ
RegulonDB: ECK120002926
ECOCYC: G6318
ASAP: ABE-0001946
UniProt: P77485
Structure
Position
complement(593328..594770)
AA seq 480 aa
MVSKPFQRPFSLATRLTFFISLATIAAFFAFAWIMIHSVKVHFAEQDINDLKEISATLER
VLNHPDETQARRLMTLEDIVSGYSNVLISLADSQGKTVYHSPGAPDIREFTRDAIPDKDA
QGGEVYLLSGPTMMMPGHGHGHMEHSNWRMINLPVGPLVDGKPIYTLYIALSIDFHLHYI
NDLMNKLIMTASVISILIVFIVLLAVHKGHAPIRSVSRQIQNITSKDLDVRLDPQTVPIE
LEQLVLSFNHMIERIEDVFTRQSNFSADIAHEIRTPITNLITQTEIALSQSRSQKELEDV
LYSNLEELTRMAKMVSDMLFLAQADNNQLIPEKKMLNLADEVGKVFDFFEALAEDRGVEL
RFVGDKCQVAGDPLMLRRALSNLLSNALRYTPTGETIVVRCQTVDHLVQVIVENPGTPIA
PEHLPRLFDRFYRVDPSRQRKGEGSGIGLAIVKSIVVAHKGTVAVTSDARGTRFVITLPA
NT seq 1443 nt   +upstreamnt  +downstreamnt
atggtcagtaagccatttcagcgcccgttttcgctggcaacccgcctgaccttttttatc
agcctggccaccatcgcggcgtttttcgcctttgcatggatcatgatccactcagtaaaa
gttcattttgccgagcaggatattaatgatttaaaagagattagcgccacccttgaacgg
gtactaaatcaccctgacgaaacgcaagcccgacgcttaatgacgctggaagatatcgtc
agtggttattccaatgtgttgatttccctggcagatagtcagggtaaaacggtgtatcac
tcccccggtgcgccggatatccgcgagtttacgcgtgacgccatacccgataaagacgct
cagggtggcgaggtgtatctcctttccggcccgacgatgatgatgccaggccacggtcac
gggcatatggaacacagcaactggcggatgattaacttgccggttggcccgttggtggac
ggcaaaccgatttatacgctctacatcgcgctttcgatcgattttcatcttcattacata
aatgatttgatgaataaacttattatgaccgcatcggtaatcagcatcctgatcgtcttt
atcgtactgttggcggtacataaaggtcacgcgccgatccgcagcgtcagccgtcaaatc
cagaatattacctcgaaagatctcgacgttcgcctcgacccgcagaccgtgcccattgag
ctggaacagctggtactgtcgttcaaccatatgatcgagcgtattgaggatgtctttacc
cgccagtccaatttctcagcggatatcgctcacgaaattcgcacaccaattacgaatctc
ataacgcaaaccgaaatcgccctcagccagtcgcgcagccagaaggagctggaagatgtg
ctctactctaatctcgaagagctgacgcgaatggcgaaaatggtcagcgatatgctgttt
ctcgctcaggccgataacaaccagctaatccccgaaaagaaaatgctcaacctggcggat
gaagtcggcaaagtgttcgattttttcgaggcgttagcggaagatcgcggcgtggagttg
cggtttgttggcgacaagtgtcaggtcgcgggcgatccgctgatgctgcgtcgggcgcta
agcaacctgctttcgaacgccctgcgttatacgccaaccggagagacaattgtagtgcgc
tgtcagacggtcgatcacctggtgcaagttatcgtcgaaaaccccggtacgcccattgcg
cccgagcacttaccgcgattgtttgaccgtttctatcgcgttgacccctcccgccagcga
aaaggtgaaggtagcggtattggcctggcgatagtgaaatcgattgttgtcgcgcataaa
ggcacggttgcggtaacgtcggatgcgcgggggacaaggtttgttatcacattacccgct
taa

DBGET integrated database retrieval system