KEGG   Escherichia coli K-12 MG1655: b0571
Entry
b0571             CDS       T00007                                 
Symbol
cusR
Name
(RefSeq) DNA-binding transcriptional activator CusR
  KO
K07665  two-component system, OmpR family, copper resistance phosphate regulon response regulator CusR
Organism
eco  Escherichia coli K-12 MG1655
Pathway
eco02020  Two-component system
Brite
KEGG Orthology (KO) [BR:eco00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    b0571 (cusR)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:eco02022]
    b0571 (cusR)
   01504 Antimicrobial resistance genes [BR:eco01504]
    b0571 (cusR)
Two-component system [BR:eco02022]
 OmpR family
  CusS-CusR (copper tolerance)
   b0571 (cusR)
Antimicrobial resistance genes [BR:eco01504]
 Gene sets
  beta-Lactam resistance modules
   Imipenem resistance, repression of porin OprD [MD:M00745]
    b0571 (cusR)
SSDB
Motif
Pfam: Response_reg Trans_reg_C MutS_I
Other DBs
NCBI-GeneID: 945003
NCBI-ProteinID: NP_415103
Pasteur: ylcA
RegulonDB: ECK120002927
ECOCYC: G6319
ASAP: ABE-0001948
UniProt: P0ACZ8
Position
complement(594760..595443)
AA seq 227 aa
MKLLIVEDEKKTGEYLTKGLTEAGFVVDLADNGLNGYHLAMTGDYDLIILDIMLPDVNGW
DIVRMLRSANKGMPILLLTALGTIEHRVKGLELGADDYLVKPFAFAELLARVRTLLRRGA
AVIIESQFQVADLMVDLVSRKVTRSGTRITLTSKEFTLLEFFLRHQGEVLPRSLIASQVW
DMNFDSDTNAIDVAVKRLRGKIDNDFEPKLIQTVRGVGYMLEVPDGQ
NT seq 684 nt   +upstreamnt  +downstreamnt
atgaaactgttgattgtcgaagatgaaaagaaaaccggagaatacttgaccaaagggtta
accgaagccggttttgtggtcgatttggccgacaacgggctgaatggctaccatctggcg
atgaccggtgattatgatctgataatcctcgatattatgctgccggacgtgaacggctgg
gatatcgtgcgcatgttacgctccgccaataaagggatgccgattctgttgcttaccgcg
cttggcaccattgaacatcgcgtcaaggggctggagttgggggcagatgactacctggtg
aagccattcgcttttgctgaactgctggcgcgggtgcgcacattactgcggcgcggggcg
gcggtgattatcgaaagtcagtttcaggttgccgatttgatggtcgatctcgtcagccgc
aaagtcacccgcagcggcacgcgcatcactttgaccagtaaagagtttactctgctggag
ttcttccttcgccatcagggcgaagtgctgccccgctcgcttatcgcctcgcaggtatgg
gacatgaattttgacagcgataccaatgctattgatgtggcggtgaagcggctgcgcggc
aaaatcgacaacgactttgagccgaagctaattcagaccgtgcgcggcgtgggttacatg
cttgaggtgccggatggtcagtaa

DBGET integrated database retrieval system