KEGG   Escherichia coli K-12 MG1655: b0014Help
Entry
b0014             CDS       T00007                                 

Gene name
dnaK
Definition
(RefSeq) chaperone Hsp70, with co-chaperone DnaJ
  KO
K04043  molecular chaperone DnaK
Organism
eco  Escherichia coli K-12 MG1655
Pathway
eco03018  RNA degradation
Brite
KEGG Orthology (KO) [BR:eco00001]
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    b0014 (dnaK)
Messenger RNA biogenesis [BR:eco03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   Other RNA degradation factors
    Chaperones
     b0014 (dnaK)
Chaperones and folding catalysts [BR:eco03110]
 Heat shock proteins
  HSP70 / DNAK
   b0014 (dnaK)
Mitochondrial biogenesis [BR:eco03029]
 Mitochondrial protein import machinery
  Inner mambrane
   MINOS/MitOS complex
    b0014 (dnaK)
  Matrix
   MMC/PAM proteins
    b0014 (dnaK)
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Proteins involved in Fe-S cluster biogenesis
    b0014 (dnaK)
Exosome [BR:eco04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   b0014 (dnaK)
  Exosomal proteins of breast cancer cells
   b0014 (dnaK)
  Exosomal proteins of colorectal cancer cells
   b0014 (dnaK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HSP70 MreB_Mbl FGGY_C
Motif
Other DBs
NCBI-GeneID: 944750
NCBI-ProteinID: NP_414555
Pasteur: dnaK
RegulonDB: ECK120000235
ECOCYC: EG10241
ASAP: ABE-0000052
UniProt: P0A6Y8
Structure
PDB: 

Position
12163..14079
Genome map
AA seq 638 aa AA seqDB search
MGKIIGIDLGTTNSCVAIMDGTTPRVLENAEGDRTTPSIIAYTQDGETLVGQPAKRQAVT
NPQNTLFAIKRLIGRRFQDEEVQRDVSIMPFKIIAADNGDAWVEVKGQKMAPPQISAEVL
KKMKKTAEDYLGEPVTEAVITVPAYFNDAQRQATKDAGRIAGLEVKRIINEPTAAALAYG
LDKGTGNRTIAVYDLGGGTFDISIIEIDEVDGEKTFEVLATNGDTHLGGEDFDSRLINYL
VEEFKKDQGIDLRNDPLAMQRLKEAAEKAKIELSSAQQTDVNLPYITADATGPKHMNIKV
TRAKLESLVEDLVNRSIEPLKVALQDAGLSVSDIDDVILVGGQTRMPMVQKKVAEFFGKE
PRKDVNPDEAVAIGAAVQGGVLTGDVKDVLLLDVTPLSLGIETMGGVMTTLIAKNTTIPT
KHSQVFSTAEDNQSAVTIHVLQGERKRAADNKSLGQFNLDGINPAPRGMPQIEVTFDIDA
DGILHVSAKDKNSGKEQKITIKASSGLNEDEIQKMVRDAEANAEADRKFEELVQTRNQGD
HLLHSTRKQVEEAGDKLPADDKTAIESALTALETALKGEDKAAIEAKMQELAQVSQKLME
IAQQQHAQQQTAGADASANNAKDDDVVDAEFEEVKDKK
NT seq 1917 nt NT seq  +upstreamnt  +downstreamnt
atgggtaaaataattggtatcgacctgggtactaccaactcttgtgtagcgattatggat
ggcaccactcctcgcgtgctggagaacgccgaaggcgatcgcaccacgccttctatcatt
gcctatacccaggatggtgaaactctagttggtcagccggctaaacgtcaggcagtgacg
aacccgcaaaacactctgtttgcgattaaacgcctgattggtcgccgcttccaggacgaa
gaagtacagcgtgatgtttccatcatgccgttcaaaattattgctgctgataacggcgac
gcatgggtcgaagttaaaggccagaaaatggcaccgccgcagatttctgctgaagtgctg
aaaaaaatgaagaaaaccgctgaagattacctgggtgaaccggtaactgaagctgttatc
accgtaccggcatactttaacgatgctcagcgtcaggcaaccaaagacgcaggccgtatc
gctggtctggaagtaaaacgtatcatcaacgaaccgaccgcagctgcgctggcttacggt
ctggacaaaggcactggcaaccgtactatcgcggtttatgacctgggtggtggtactttc
gatatttctattatcgaaatcgacgaagttgacggcgaaaaaaccttcgaagttctggca
accaacggtgatacccacctggggggtgaagacttcgacagccgtctgatcaactatctg
gttgaagaattcaagaaagatcagggcattgacctgcgcaacgatccgctggcaatgcag
cgcctgaaagaagcggcagaaaaagcgaaaatcgaactgtcttccgctcagcagaccgac
gttaacctgccatacatcactgcagacgcgaccggtccgaaacacatgaacatcaaagtg
actcgtgcgaaactggaaagcctggttgaagatctggtaaaccgttccattgagccgctg
aaagttgcactgcaggacgctggcctgtccgtatctgatatcgacgacgttatcctcgtt
ggtggtcagactcgtatgccaatggttcagaagaaagttgctgagttctttggtaaagag
ccgcgtaaagacgttaacccggacgaagctgtagcaatcggtgctgctgttcagggtggt
gttctgactggtgacgtaaaagacgtactgctgctggacgttaccccgctgtctctgggt
atcgaaaccatgggcggtgtgatgacgacgctgatcgcgaaaaacaccactatcccgacc
aagcacagccaggtgttctctaccgctgaagacaaccagtctgcggtaaccatccatgtg
ctgcagggtgaacgtaaacgtgcggctgataacaaatctctgggtcagttcaacctagat
ggtatcaacccggcaccgcgcggcatgccgcagatcgaagttaccttcgatatcgatgct
gacggtatcctgcacgtttccgcgaaagataaaaacagcggtaaagagcagaagatcacc
atcaaggcttcttctggtctgaacgaagatgaaatccagaaaatggtacgcgacgcagaa
gctaacgccgaagctgaccgtaagtttgaagagctggtacagactcgcaaccagggcgac
catctgctgcacagcacccgtaagcaggttgaagaagcaggcgacaaactgccggctgac
gacaaaactgctatcgagtctgcgctgactgcactggaaactgctctgaaaggtgaagac
aaagccgctatcgaagcgaaaatgcaggaactggcacaggtttcccagaaactgatggaa
atcgcccagcagcaacatgcccagcagcagactgccggtgctgatgcttctgcaaacaac
gcgaaagatgacgatgttgtcgacgctgaatttgaagaagtcaaagacaaaaaataa

DBGET integrated database retrieval system