KEGG   Escherichia coli K-12 MG1655: b0044Help
Entry
b0044             CDS       T00007                                 

Gene name
fixX
Definition
(RefSeq) putative 4Fe-4S ferredoxin-type protein
  KO
K03855  ferredoxin like protein
Organism
eco  Escherichia coli K-12 MG1655
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ETF_QO Fer4_9 Fer4_10 Fer4_2
Motif
Other DBs
NCBI-GeneID: 948590
NCBI-ProteinID: NP_414586
Pasteur: fixX
RegulonDB: ECK120001518
ECOCYC: EG11565
ASAP: ABE-0000151
UniProt: P68646
Position
45463..45750
Genome map
AA seq 95 aa AA seqDB search
MTSPVNVDVKLGVNKFNVDEEHPHIVVKADADKQALELLVKACPAGLYKKQDDGSVRFDY
AGCLECGTCRILGLGSALEQWEYPRGTFGVEFRYG
NT seq 288 nt NT seq  +upstreamnt  +downstreamnt
atgacttctcccgtcaatgtggacgtcaaactgggcgtcaataaattcaatgtcgatgaa
gagcatccgcacattgttgtgaaggccgatgctgataaacaggcgctggagctgctggtg
aaagcgtgccccgcaggtctgtacaagaagcaggatgacggcagtgtgcgcttcgattac
gccggatgtctggagtgcggcacctgtcgcattctggggctggggtcggcgctggaacag
tgggaatacccgcgcggcacctttggtgtggagttccgttacggctga

DBGET integrated database retrieval system