KEGG   Escherichia coli K-12 MG1655: b0045
Entry
b0045             CDS       T00007                                 

Symbol
yaaU
Name
(RefSeq) putative transporter YaaU
  KO
K08368  MFS transporter, putative metabolite transport protein
Organism
eco  Escherichia coli K-12 MG1655
Brite
KEGG Orthology (KO) [BR:eco00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:eco02000]
    b0045 (yaaU)
Transporters [BR:eco02000]
 Major facilitator superfamily (MFS)
  Unknown transporters
   Others
    b0045 (yaaU)
SSDB
Motif
Pfam: Sugar_tr MFS_1
Other DBs
NCBI-GeneID: 944766
NCBI-ProteinID: NP_414587
Pasteur: yaaU
RegulonDB: ECK120001519
ECOCYC: EG11566
ASAP: ABE-0000156
UniProt: P31679
Position
45807..47138
AA seq 443 aa
MQPSRNFDDLKFSSIHRRILLWGSGGPFLDGYVLVMIGVALEQLTPALKLDADWIGLLGA
GTLAGLFVGTSLFGYISDKVGRRKMFLIDIIAIGVISVATMFVSSPVELLVMRVLIGIVI
GADYPIATSMITEFSSTRQRAFSISFIAAMWYVGATCADLVGYWLYDVEGGWRWMLGSAA
IPCLLILIGRFELPESPRWLLRKGRVKECEEMMIKLFGEPVAFDEEQPQQTRFRDLFNRR
HFPFVLFVAAIWTCQVIPMFAIYTFGPQIVGLLGLGVGKNAALGNVVISLFFMLGCIPPM
LWLNTAGRRPLLIGSFAMMTLALAVLGLIPDMGIWLVVMAFAVYAFFSGGPGNLQWLYPN
ELFPTDIRASAVGVIMSLSRIGTIVSTWALPIFINNYGISNTMLMGAGISLFGLLISVAF
APETRGMSLAQTSNMTIRGQRMG
NT seq 1332 nt   +upstreamnt  +downstreamnt
atgcaaccgtccagaaactttgacgatctcaaattctcctctattcaccgccgcattttg
ctgtggggaagcggtggtccgtttctggatggttatgtactggtaatgattggcgtggcg
ctggagcaactgacgccggcgctgaaactggacgctgactggattggcttgctgggcgcg
ggaacgctcgccgggctgttcgttggcacatcgctgtttggttatatttccgataaagtc
ggacggcgcaaaatgttcctcattgatatcatcgccatcggcgtgatatcggtggcgacg
atgtttgtttcatcccccgtcgaactgttggtgatgcgggtacttatcggcattgtcatc
ggtgcagattatcccatcgccacctcaatgatcaccgagttctccagtacccgtcagcgg
gcgttttccatcagctttattgccgcgatgtggtatgtcggcgcgacctgtgccgatctg
gtcggctactggctttatgatgtggaaggcggctggcgctggatgctgggtagcgcggcg
atcccctgtttgttgattttgattggtcgattcgaactgcctgaatctccccgctggtta
ttacgcaaagggcgagtaaaagagtgcgaagagatgatgatcaaactgtttggcgaaccg
gtggctttcgatgaagagcagccgcagcaaacccgttttcgcgatctgtttaatcgccgc
cattttccttttgttctgtttgttgccgccatctggacctgccaggtgatcccaatgttc
gccatttacacctttggcccgcaaatcgttggtttgttgggattgggggttggcaaaaac
gcggcactagggaatgtggtgattagcctgttctttatgctcggctgtattccgccgatg
ctgtggttaaacactgccggacggcgtccattgttgattggcagctttgccatgatgacg
ctggcgctggcggttttggggctaatcccggatatggggatctggctggtagtgatggcc
tttgcggtgtatgcctttttctctggcgggccgggtaatttgcagtggctctatcctaat
gaactcttcccgacagatatccgcgcctctgccgtgggcgtgattatgtccttaagtcgt
attggcaccattgtttcgacctgggcactaccgatctttatcaataattacggtatcagt
aacacgatgctaatgggggcgggtatctcgctgtttggcttgttgatttccgtagcgttt
gccccggagactcgagggatgtcactggcgcagaccagcaatatgacgatccgcgggcag
agaatggggtaa

DBGET integrated database retrieval system