KEGG   Escherichia coli K-12 MG1655: b0077Help
Entry
b0077             CDS       T00007                                 

Gene name
ilvI
Definition
(RefSeq) acetolactate synthase/acetohydroxybutanoate synthase, catalytic subunit
  KO
K01652  acetolactate synthase I/II/III large subunit [EC:2.2.1.6]
Organism
eco  Escherichia coli K-12 MG1655
Pathway
eco00290  Valine, leucine and isoleucine biosynthesis
eco00650  Butanoate metabolism
eco00660  C5-Branched dibasic acid metabolism
eco00770  Pantothenate and CoA biosynthesis
eco01100  Metabolic pathways
eco01110  Biosynthesis of secondary metabolites
eco01130  Biosynthesis of antibiotics
eco01210  2-Oxocarboxylic acid metabolism
eco01230  Biosynthesis of amino acids
Module
eco_M00019  Valine/isoleucine biosynthesis, pyruvate => valine / 2-oxobutanoate => isoleucine
eco_M00570  Isoleucine biosynthesis, threonine => 2-oxobutanoate => isoleucine
Brite
KEGG Orthology (KO) [BR:eco00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    b0077 (ilvI)
   00660 C5-Branched dibasic acid metabolism
    b0077 (ilvI)
  09105 Amino acid metabolism
   00290 Valine, leucine and isoleucine biosynthesis
    b0077 (ilvI)
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    b0077 (ilvI)
Enzymes [BR:eco01000]
 2. Transferases
  2.2  Transferring aldehyde or ketonic groups
   2.2.1  Transketolases and transaldolases
    2.2.1.6  acetolactate synthase
     b0077 (ilvI)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TPP_enzyme_N TPP_enzyme_C TPP_enzyme_M POR_N ROQ_II
Motif
Other DBs
NCBI-GeneID: 948793
NCBI-ProteinID: YP_025294
Pasteur: ilvI
RegulonDB: ECK120000493
ECOCYC: EG10500
ASAP: ABE-0000290
UniProt: P00893 A0A387D5N1
Position
85630..87354
Genome map
AA seq 574 aa AA seqDB search
MEMLSGAEMVVRSLIDQGVKQVFGYPGGAVLDIYDALHTVGGIDHVLVRHEQAAVHMADG
LARATGEVGVVLVTSGPGATNAITGIATAYMDSIPLVVLSGQVATSLIGYDAFQECDMVG
ISRPVVKHSFLVKQTEDIPQVLKKAFWLAASGRPGPVVVDLPKDILNPANKLPYVWPESV
SMRSYNPTTTGHKGQIKRALQTLVAAKKPVVYVGGGAITAGCHQQLKETVEALNLPVVCS
LMGLGAFPATHRQALGMLGMHGTYEANMTMHNADVIFAVGVRFDDRTTNNLAKYCPNATV
LHIDIDPTSISKTVTADIPIVGDARQVLEQMLELLSQESAHQPLDEIRDWWQQIEQWRAR
QCLKYDTHSEKIKPQAVIETLWRLTKGDAYVTSDVGQHQMFAALYYPFDKPRRWINSGGL
GTMGFGLPAALGVKMALPEETVVCVTGDGSIQMNIQELSTALQYELPVLVVNLNNRYLGM
VKQWQDMIYSGRHSQSYMQSLPDFVRLAEAYGHVGIQISHPHELESKLSEALEQVRNNRL
VFVDVTVDGSEHVYPMQIRGGGMDEMWLSKTERT
NT seq 1725 nt NT seq  +upstreamnt  +downstreamnt
atggagatgttgtctggagccgagatggtcgtccgatcgcttatcgatcagggcgttaaa
caagtattcggttatcccggaggcgcagtccttgatatttatgatgcattgcataccgtg
ggtggtattgatcatgtattagttcgtcatgagcaggcggcggtgcatatggccgatggc
ctggcgcgcgcgaccggggaagtcggcgtcgtgctggtaacgtcgggtccaggggcgacc
aatgcgattactggcatcgccaccgcttatatggattccattccattagttgtcctttcc
gggcaggtagcgacctcgttgataggttacgatgcctttcaggagtgcgacatggtgggg
atttcgcgaccggtggttaaacacagttttctggttaagcaaacggaagacattccgcag
gtgctgaaaaaggctttctggctggcggcaagtggtcgcccaggaccagtagtcgttgat
ttaccgaaagatattcttaatccggcgaacaaattaccctatgtctggccggagtcggtc
agtatgcgttcttacaatcccactactaccggacataaagggcaaattaagcgtgctctg
caaacgctggtagcggcaaaaaaaccggttgtctacgtaggcggtggggcaatcacggcg
ggctgccatcagcagttgaaagaaacggtggaggcgttgaatctgcccgttgtttgctca
ttgatggggctgggggcgtttccggcaacgcatcgtcaggcactgggcatgctgggaatg
cacggtacctacgaagccaatatgacgatgcataacgcggatgtgattttcgccgtcggg
gtacgatttgatgaccgaacgacgaacaatctggcaaagtactgcccaaatgccactgtt
ctgcatatcgatattgatcctacttccatttctaaaaccgtgactgcggatatcccgatt
gtgggggatgctcgccaggtcctcgaacaaatgcttgaactcttgtcgcaagaatccgcc
catcaaccactggatgagatccgcgactggtggcagcaaattgaacagtggcgcgctcgt
cagtgcctgaaatatgacactcacagtgaaaagattaaaccgcaggcggtgatcgagact
ctttggcggttgacgaagggagacgcttacgtgacgtccgatgtcgggcagcaccagatg
tttgctgcactttattatccattcgacaaaccgcgtcgctggatcaattccggtggcctc
ggcacgatgggttttggtttacctgcggcactgggcgtcaaaatggcgttgccagaagaa
accgtggtttgcgtcactggcgacggcagtattcagatgaacatccaggaactgtctacc
gcgttgcaatacgagttgcccgtactggtggtgaatctcaataaccgctatctggggatg
gtgaagcagtggcaggacatgatctattccggccgtcattcacaatcttatatgcaatcg
ctacccgatttcgtccgtctggcggaagcctatgggcatgtcgggatccagatttctcat
ccgcatgagctggaaagcaaacttagcgaggcgctggaacaggtgcgcaataatcgcctg
gtgtttgttgatgttaccgtcgatggcagcgagcacgtctacccgatgcagattcgcggg
ggcggaatggatgaaatgtggttaagcaaaacggagagaacctga

DBGET integrated database retrieval system