KEGG   Escherichia coli K-12 MG1655: b0086Help
Entry
b0086             CDS       T00007                                 

Gene name
murF
Definition
(RefSeq) D-alanyl-D-alanine-adding enzyme
  KO
K01929  UDP-N-acetylmuramoyl-tripeptide--D-alanyl-D-alanine ligase [EC:6.3.2.10]
Organism
eco  Escherichia coli K-12 MG1655
Pathway
eco00300  Lysine biosynthesis
eco00550  Peptidoglycan biosynthesis
eco01100  Metabolic pathways
eco01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:eco00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00300 Lysine biosynthesis
    b0086 (murF)
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    b0086 (murF)
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    b0086 (murF)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:eco01011]
    b0086 (murF)
Enzymes [BR:eco01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.10  UDP-N-acetylmuramoyl-tripeptide---D-alanyl-D-alanine ligase
     b0086 (murF)
Peptidoglycan biosynthesis and degradation proteins [BR:eco01011]
 Precursor biosynthesis
  Amino acid ligase
   b0086 (murF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mur_ligase_M Mur_ligase_C Mur_ligase LpxD
Motif
Other DBs
NCBI-GeneID: 944813
NCBI-ProteinID: NP_414628
Pasteur: murF
RegulonDB: ECK120000615
ECOCYC: EG10622
ASAP: ABE-0000313
UniProt: P11880
Structure
PDB: 

Position
94650..96008
Genome map
AA seq 452 aa AA seqDB search
MISVTLSQLTDILNGELQGADITLDAVTTDTRKLTPGCLFVALKGERFDAHDFADQAKAG
GAGALLVSRPLDIDLPQLIVKDTRLAFGELAAWVRQQVPARVVALTGSSGKTSVKEMTAA
ILSQCGNTLYTAGNLNNDIGVPMTLLRLTPEYDYAVIELGANHQGEIAWTVSLTRPEAAL
VNNLAAAHLEGFGSLAGVAKAKGEIFSGLPENGIAIMNADNNDWLNWQSVIGSRKVWRFS
PNAANSDFTATNIHVTSHGTEFTLQTPTGSVDVLLPLPGRHNIANALAAAALSMSVGATL
DAIKAGLANLKAVPGRLFPIQLAENQLLLDDSYNANVGSMTAAVQVLAEMPGYRVLVVGD
MAELGAESEACHVQVGEAAKAAGIDRVLSVGKQSHAISTASGVGEHFADKTALITRLKLL
IAEQQVITILVKGSRSAAMEEVVRALQENGTC
NT seq 1359 nt NT seq  +upstreamnt  +downstreamnt
atgattagcgtaacccttagccaacttaccgacattctcaacggtgaactgcaaggtgca
gatatcacccttgatgctgtaaccactgatacccgaaaactgacgccgggctgcctgttt
gttgccctgaaaggcgaacgttttgatgcccacgattttgccgaccaggcgaaagctggc
ggcgcaggcgcactactggttagccgtccgctggacatcgacctgccgcagttaatcgtc
aaggatacgcgtctggcgtttggtgaactggctgcatgggttcgccagcaagttccggcg
cgcgtggttgctctgacggggtcctccggcaaaacctccgttaaagagatgacggcggcg
attttaagccagtgcggcaacacgctttatacggcaggcaatctcaacaacgacatcggt
gtaccgatgacgctgttgcgcttaacgccggaatacgattacgcagttattgaacttggc
gcgaaccatcagggcgaaatagcctggactgtgagtctgactcgcccggaagctgcgctg
gtcaacaacctggcagcggcgcatctggaaggttttggctcgcttgcgggtgtcgcgaaa
gcgaaaggtgaaatctttagcggcctgccggaaaacggtatcgccattatgaacgccgac
aacaacgactggctgaactggcagagcgtaattggctcacgcaaagtgtggcgtttctca
cccaatgccgccaacagcgatttcaccgccaccaatatccatgtgacctcgcacggtacg
gaatttaccctacaaaccccaaccggtagcgtcgatgttctgctgccgttgccggggcgt
cacaatattgcgaatgcgctggcagccgctgcgctctccatgtccgtgggcgcaacgctt
gatgctatcaaagcggggctggcaaatctgaaagctgttccaggccgtctgttccccatc
caactggcagaaaaccagttgctgctcgacgactcctacaacgccaatgtcggttcaatg
actgcagcagtccaggtactggctgaaatgccgggctaccgcgtgctggtggtgggcgat
atggcggaactgggcgctgaaagcgaagcctgccatgtacaggtgggcgaggcggcaaaa
gctgctggtattgaccgcgtgttaagcgtgggtaaacaaagccatgctatcagcaccgcc
agcggcgttggcgaacattttgctgataaaactgcgttaattacgcgtcttaaattactg
attgctgagcaacaggtaattacgattttagttaagggttcacgtagtgccgccatggaa
gaggtagtacgcgctttacaggagaatgggacatgttag

DBGET integrated database retrieval system