KEGG   Escherichia coli K-12 MG1655: b0112
Entry
b0112             CDS       T00007                                 
Symbol
aroP
Name
(RefSeq) aromatic amino acid:H(+) symporter AroP
  KO
K11734  aromatic amino acid transport protein AroP
Organism
eco  Escherichia coli K-12 MG1655
Brite
KEGG Orthology (KO) [BR:eco00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:eco02000]
    b0112 (aroP)
Transporters [BR:eco02000]
 Other transporters
  Electrochemical potential-driven transporters [TC:2]
   b0112 (aroP)
SSDB
Motif
Pfam: AA_permease AA_permease_2
Other DBs
NCBI-GeneID: 946018
NCBI-ProteinID: NP_414654
Pasteur: aroP
RegulonDB: ECK120000080
ECOCYC: EG10084
ASAP: ABE-0000384
UniProt: P15993
Position
complement(120178..121551)
AA seq 457 aa
MMEGQQHGEQLKRGLKNRHIQLIALGGAIGTGLFLGSASVIQSAGPGIILGYAIAGFIAF
LIMRQLGEMVVEEPVAGSFSHFAYKYWGSFAGFASGWNYWVLYVLVAMAELTAVGKYIQF
WYPEIPTWVSAAVFFVVINAINLTNVKVFGEMEFWFAIIKVIAVVAMIIFGGWLLFSGNG
GPQATVSNLWDQGGFLPHGFTGLVMMMAIIMFSFGGLELVGITAAEADNPEQSIPKATNQ
VIYRILIFYIGSLAVLLSLMPWTRVTADTSPFVLIFHELGDTFVANALNIVVLTAALSVY
NSCVYCNSRMLFGLAQQGNAPKALASVDKRGVPVNTILVSALVTALCVLINYLAPESAFG
LLMALVVSALVINWAMISLAHMKFRRAKQEQGVVTRFPALLYPLGNWICLLFMAAVLVIM
LMTPGMAISVYLIPVWLIVLGIGYLFKEKTAKAVKAH
NT seq 1374 nt   +upstreamnt  +downstreamnt
atgatggaaggtcaacagcacggcgagcagctaaagcgcggccttaaaaaccgccatatt
cagcttatcgcgctgggtggcgcgatagggaccgggttattcctgggtagcgcctccgta
atacagtccgcagggccagggattatcctgggttacgccattgctggttttatcgccttt
ctgatcatgcgtcagctgggtgaaatggtggtcgaagaacctgtcgcaggctcctttagc
cactttgcttataaatactggggcagttttgccggtttcgcctctggctggaactactgg
gtactgtacgttttagttgccatggctgagctgactgccgtgggtaaatacattcagttc
tggtatccggaaatccccacctgggtttctgccgccgtattctttgtggtgattaacgcc
atcaacctgaccaacgttaaagtgtttggcgagatggagttctggtttgccattatcaaa
gttatcgcggtggtagcgatgatcatcttcggcggctggctgctattcagtggcaacggc
ggcccgcaggcgaccgttagcaacctgtgggatcagggtggtttcctgccgcacggcttc
accgggctggtgatgatgatggcgattatcatgttctcgttcggtggtctggaactggtg
gggatcaccgcagcagaagctgataacccggagcaaagtataccgaaagcaactaaccag
gttatctaccgcatcctgattttctatattggttcgttagccgttctgctctcactgatg
ccgtggacccgcgttaccgccgataccagtccgtttgtgctgatcttccacgagttaggc
gatacctttgtggcgaatgcgctgaacatcgtggtactgactgcggcgctctccgtgtac
aacagctgcgtatattgcaacagccgtatgctgtttggtctggcacaacagggtaatgcg
ccaaaagcgctggcgtctgtcgataaacgtggtgtaccagtaaataccattctggtgtct
gcactggtaacggcgttgtgcgtactgattaactaccttgccccagagtccgctttcgga
ctgttaatggcgctggtggtatctgcactggtaatcaactgggcgatgattagcctggcg
catatgaaattccgtcgcgccaagcaggaacaaggcgtggtaactcgcttccctgctctg
ctttatccgctgggtaactggatctgcctgctgtttatggcggcggtactggtgattatg
ctgatgaccccaggaatggcgatttcggtatacctgatcccggtatggctgatcgtgtta
ggtatcggctatctgtttaaagagaaaaccgccaaagccgtaaaagcgcattaa

DBGET integrated database retrieval system