KEGG   Escherichia coli K-12 MG1655: b0125
Entry
b0125             CDS       T00007                                 

Gene name
hpt
Definition
(RefSeq) hypoxanthine phosphoribosyltransferase
  KO
K00760  hypoxanthine phosphoribosyltransferase [EC:2.4.2.8]
Organism
eco  Escherichia coli K-12 MG1655
Pathway
eco00230  Purine metabolism
eco01100  Metabolic pathways
eco01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:eco00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    b0125 (hpt)
Enzymes [BR:eco01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.8  hypoxanthine phosphoribosyltransferase
     b0125 (hpt)
SSDB
Motif
Pfam: Pribosyltran UPRTase
Other DBs
NCBI-GeneID: 946624
NCBI-ProteinID: NP_414667
RegulonDB: ECK120002443
ECOCYC: EG20098
ASAP: ABE-0000440
UniProt: P0A9M2
Structure
PDB: 

Position
141431..141967
AA seq 178 aa
MKHTVEVMIPEAEIKARIAELGRQITERYKDSGSDMVLVGLLRGSFMFMADLCREVQVSH
EVDFMTASSYGSGMSTTRDVKILKDLDEDIRGKDVLIVEDIIDSGNTLSKVREILSLREP
KSLAICTLLDKPSRREVNVPVEFIGFSIPDEFVVGYGIDYAQRYRHLPYIGKVILLDE
NT seq 537 nt   +upstreamnt  +downstreamnt
atgaaacatactgtagaagtaatgatccccgaagcggagattaaagcgcgtatcgccgaa
ctgggtcgtcagattactgagcgttacaaagacagcggcagcgatatggtgctggtgggt
ctgctgcgtggctcatttatgtttatggcggacctgtgccgtgaagttcaggtatctcat
gaagtcgactttatgaccgcctccagctacggtagcggcatgtccaccacccgtgatgtg
aaaatcctcaaagatctggatgaagatatccgtggcaaggacgtgctgattgttgaagat
atcatcgactcggggaatacactgtcgaaagtgcgtgagatcttaagcctgcgcgaaccg
aagtcgctggcgatttgtacgctgctggataaaccgtcccgtcgtgaagtgaacgtcccg
gtagaatttatcggtttctcgatcccggatgagtttgtggtgggttacggcattgattac
gcacagcgttaccgtcatctgccgtatatcggcaaagtgattctgctggacgagtaa

DBGET integrated database retrieval system