KEGG   Escherichia coli K-12 MG1655: b0134Help
Entry
b0134             CDS       T00007                                 

Gene name
panB
Definition
(RefSeq) 3-methyl-2-oxobutanoate hydroxymethyltransferase
  KO
K00606  3-methyl-2-oxobutanoate hydroxymethyltransferase [EC:2.1.2.11]
Organism
eco  Escherichia coli K-12 MG1655
Pathway
eco00770  Pantothenate and CoA biosynthesis
eco01100  Metabolic pathways
eco01110  Biosynthesis of secondary metabolites
Module
eco_M00119  Pantothenate biosynthesis, valine/L-aspartate => pantothenate
Brite
KEGG Orthology (KO) [BR:eco00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    b0134 (panB)
Enzymes [BR:eco01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.2  Hydroxymethyl-, formyl- and related transferases
    2.1.2.11  3-methyl-2-oxobutanoate hydroxymethyltransferase
     b0134 (panB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pantoate_transf Asp_Glu_race PEP_mutase
Motif
Other DBs
NCBI-GeneID: 944839
NCBI-ProteinID: NP_414676
Pasteur: panB
RegulonDB: ECK120001618
ECOCYC: EG11675
ASAP: ABE-0000467
UniProt: P31057
Structure
PDB: 

Position
complement(148807..149601)
Genome map
AA seq 264 aa AA seqDB search
MKPTTISLLQKYKQEKKRFATITAYDYSFAKLFADEGLNVMLVGDSLGMTVQGHDSTLPV
TVADIAYHTAAVRRGAPNCLLLADLPFMAYATPEQAFENAATVMRAGANMVKIEGGEWLV
ETVQMLTERAVPVCGHLGLTPQSVNIFGGYKVQGRGDEAGDQLLSDALALEAAGAQLLVL
ECVPVELAKRITEALAIPVIGIGAGNVTDGQILVMHDAFGITGGHIPKFAKNFLAETGDI
RAAVRQYMAEVESGVYPGEEHSFH
NT seq 795 nt NT seq  +upstreamnt  +downstreamnt
atgaaaccgaccaccatctccttactgcagaagtacaaacaggaaaaaaaacgtttcgcg
accatcaccgcttatgactatagcttcgccaaactctttgctgatgaagggcttaacgtc
atgctggtgggcgattcgctgggcatgacggttcaggggcacgactccaccctgccagtt
accgttgccgatatcgcctaccacactgccgccgtacgtcgcggcgcaccaaactgcctg
ctgctggctgacctgccgtttatggcgtatgccacgccggaacaagccttcgaaaacgcc
gcaacggttatgcgtgccggtgctaacatggtcaaaattgaaggcggtgagtggctggta
gaaaccgtacaaatgctgaccgaacgtgccgttcctgtatgtggtcacttaggtttaaca
ccacagtcagtgaatattttcggtggctacaaagttcaggggcgcggcgatgaagcgggc
gatcaactgctcagcgatgcattagccttagaagctgctggggcacagctgctggtgctg
gaatgcgtgccggttgaactggcaaaacgtattaccgaagcactggcgatcccggttatt
ggcattggcgcaggcaacgtcactgacgggcagatcctcgtgatgcacgacgcctttggt
attaccggcggtcacattcctaaattcgctaaaaatttcctcgccgaaacgggcgacatc
cgcgcggctgtgcggcagtatatggctgaagtggagtccggcgtttatccgggcgaagaa
cacagtttccattaa

DBGET integrated database retrieval system