KEGG   Escherichia coli K-12 MG1655: b0141Help
Entry
b0141             CDS       T00007                                 

Gene name
yadN
Definition
(RefSeq) putative fimbrial-like adhesin protein
Organism
eco  Escherichia coli K-12 MG1655
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fimbrial
Motif
Other DBs
NCBI-GeneID: 944841
NCBI-ProteinID: NP_414683
Pasteur: yadN
RegulonDB: ECK120002203
ECOCYC: EG12328
ASAP: ABE-0000487
UniProt: P37050
Position
complement(156299..156883)
Genome map
AA seq 194 aa AA seqDB search
MSKKLGFALSGLMLAMVAGTASADMDGGQLNISGLVVDNTCETRVDGGNKDGLILLQTAT
VGEIDAGVLNDTVGAKAKPFSITVDCSKANPNPGSTAKMTFGSVFFGNSKGTLNNDMSIN
NPSDGVNIALHNIDGSTIKQVQINNPGDVYTKALDATTKSAVYDFKASYVRAVADQTATA
GYVKTNTAYTITYQ
NT seq 585 nt NT seq  +upstreamnt  +downstreamnt
atgtctaaaaaattaggttttgccctgtctggtcttatgctggcgatggttgcaggtact
gcttctgctgatatggacggcggtcagttaaatatcagtggtctggttgttgataacacc
tgtgaaacccgcgttgacggcggtaacaaggatggtctgatcctgctgcaaaccgcaacc
gttggtgaaatcgatgctggcgtactgaatgacaccgttggcgctaaagctaaacctttc
agcatcaccgttgactgcagcaaagcaaatccgaatccaggtagcacggctaaaatgacc
ttcggttctgttttctttggtaacagcaaagggactttgaacaacgacatgtctattaac
aacccatctgacggcgttaatatcgctctacacaatattgatggttccactatcaaacag
gttcaaattaacaaccctggcgatgtgtatactaaagccctggatgcaacgacaaaatct
gctgtttatgattttaaagcgtcttacgttcgtgccgtcgcagaccaaacagcaactgct
ggttatgtaaaaactaacactgcatacaccattacttatcagtaa

DBGET integrated database retrieval system