KEGG   Escherichia coli K-12 MG1655: b0157Help
Entry
b0157             CDS       T00007                                 

Gene name
yadS
Definition
(RefSeq) UPF0126 family inner membrane protein
Organism
eco  Escherichia coli K-12 MG1655
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: UPF0126 AzlD
Motif
Other DBs
NCBI-GeneID: 949062
NCBI-ProteinID: NP_414699
Pasteur: yadS
RegulonDB: ECK120002208
ECOCYC: EG12333
ASAP: ABE-0000540
UniProt: P0AFP0
Position
complement(177001..177624)
Genome map
AA seq 207 aa AA seqDB search
MLVYWLDIVGTAVFAISGVLLAGKLRMDPFGVLVLGVVTAVGGGTIRDMALDHGPVFWVK
DPTDLVVAMVTSMLTIVLVRQPRRLPKWMLPVLDAVGLAVFVGIGVNKAFNAEAGPLIAV
CMGVITGVGGGIIRDVLAREIPMILRTEIYATACIIGGIVHATAYYTFSVPLETASMMGM
VVTLLIRLAAIRWHLKLPTFALDENGR
NT seq 624 nt NT seq  +upstreamnt  +downstreamnt
atgctcgtctattggctggatatagtcggcacagcggtatttgccatctccggcgttttg
ttagccggaaaattgcgtatggacccttttggtgttctggtactgggcgtggtaaccgca
gtaggcggcgggacaattcgcgacatggcgctggatcacggcccggtattttgggtgaaa
gatcccaccgatctggtcgttgcaatggtcaccagcatgctgaccatcgtgctggtgcgc
cagccaagacgcttaccaaaatggatgttgccggtgctggacgccgttggtctggcggtg
tttgtcggcattggcgtgaataaagcctttaatgcggaagccggtccgttaatcgcggtt
tgtatgggcgtcattactggcgttggcggcgggatcattcgtgatgttctggcccgcgaa
atccccatgattttacgtacagaaatctacgcaactgcctgtattatcggcggtattgtc
cacgctacggcttattacacattttccgtaccactggaaacagccagtatgatgggcatg
gtcgtgacgctattgattcggctggcggctattcgttggcatcttaagctaccgacgttt
gcgctggatgagaatgggcgttga

DBGET integrated database retrieval system