KEGG   Escherichia coli K-12 MG1655: b0158Help
Entry
b0158             CDS       T00007                                 

Gene name
btuF
Definition
(RefSeq) vitamin B12 ABC transporter periplasmic binding protein
  KO
K06858  vitamin B12 transport system substrate-binding protein
Organism
eco  Escherichia coli K-12 MG1655
Pathway
eco02010  ABC transporters
Module
eco_M00241  Vitamin B12 transport system
Brite
KEGG Orthology (KO) [BR:eco00001]
 Environmental Information Processing
  Membrane transport
   02010 ABC transporters
    b0158 (btuF)
Transporters [BR:eco02000]
 ABC Transporters, Prokaryotic Type
  Metallic cation, iron-siderophore and vitamin B12 transporters
   Vitamin B12 transporter [MD:M00241] [OT]
    b0158 (btuF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peripla_BP_2 DUF2493 DUF2397 Lipase_GDSL_2 DUF4124
Motif
Other DBs
NCBI-GeneID: 947574
NCBI-ProteinID: NP_414700
Pasteur: yadT
RegulonDB: ECK120002209
ECOCYC: EG12334
ASAP: ABE-0000542
UniProt: P37028
Structure
PDB: 

Position
complement(177662..178462)
Genome map
AA seq 266 aa AA seqDB search
MAKSLFRALVALSFLAPLWLNAAPRVITLSPANTELAFAAGITPVGVSSYSDYPPQAQKI
EQVSTWQGMNLERIVALKPDLVIAWRGGNAERQVDQLASLGIKVMWVDATSIEQIANALR
QLAPWSPQPDKAEQAAQSLLDQYAQLKAQYADKPKKRVFLQFGINPPFTSGKESIQNQVL
EVCGGENIFKDSRVPWPQVSREQVLARSPQAIVITGGPDQIPKIKQYWGEQLKIPVIPLT
SDWFERASPRIILAAQQLCNALSQVD
NT seq 801 nt NT seq  +upstreamnt  +downstreamnt
atggctaagtcactgttcagggcgctggtcgccctgtcttttcttgcgccactgtggctc
aacgccgcgccgcgcgtcatcacgctttctcccgccaacactgaacttgcctttgccgcc
gggatcacgccggttggggtcagcagctattccgactatcctccacaagcgcaaaagatt
gagcaggtttccacctggcaggggatgaatctggaacgcattgtcgcgctgaaacccgat
ctggtgattgcctggcgtggaggtaatgccgagcggcaggttgaccagctggcttcgctg
ggaataaaagtgatgtgggtcgatgcgacaagcattgaacaaattgccaatgcgttacgt
caactggccccctggagtccgcaaccagacaaggccgaacaagccgcgcaatccctgctg
gatcagtacgcgcaattgaaagcgcaatatgctgataaacctaaaaaacgtgtttttctg
caattcggcattaatccgccatttaccagtggaaaagagtcgattcagaaccaggtactc
gaagtttgtggcggagaaaacatctttaaagacagccgggttccctggccgcaagttagc
cgcgaacaggtgttagcacgctcgccacaggcgattgtcattacaggcggaccggaccaa
attcctaaaatcaaacaatactggggtgaacagctcaaaattcccgttattcctctcacg
agtgactggtttgaacgtgcaagcccacgtattatcctcgctgcacaacagctctgtaat
gcgctttcacaggtagattag

DBGET integrated database retrieval system