KEGG   Escherichia coli K-12 MG1655: b0164Help
Entry
b0164             CDS       T00007                                 

Gene name
yaeI
Definition
(RefSeq) phosphodiesterase with model substrate bis-pNPP
  KO
K07098  uncharacterized protein
Organism
eco  Escherichia coli K-12 MG1655
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Metallophos Metallophos_2 TAT_signal
Motif
Other DBs
NCBI-GeneID: 945002
NCBI-ProteinID: NP_414706
Pasteur: yaeI
RegulonDB: ECK120002212
ECOCYC: EG12337
ASAP: ABE-0000559
UniProt: P37049
Position
complement(184257..185069)
Genome map
AA seq 270 aa AA seqDB search
MISRRRFLQATAATIATSSGFGYMHYCEPGWFELIRHRLAFFKDNAAPFKILFLADLHYS
RFVPLSLISDAIALGIEQKPDLILLGGDYVLFDMSLNFSAFSDVLSPLAECAPTFACFGN
HDRPVGTEKNHLIGETLKSAGITVLFNQATVIATPNRQFELVGTGDLWAGQCKPPPASEA
NLPRLVLAHNPDSKEVMRDEPWDLMLCGHTHGGQLRVPLVGEPFAPVEDKRYVAGLNAFG
ERHIYTTRGVGSLYGLRLNCRPEVTMLELV
NT seq 813 nt NT seq  +upstreamnt  +downstreamnt
atgatttcacgccgccgatttttgcaggctactgccgcgacgatagccacgagctcaggt
ttcggttatatgcattactgtgagccaggctggtttgaattaatccgtcaccgcctcgcc
ttttttaaagacaacgcagcaccattcaaaattctttttctggccgatctccattactct
cgttttgttcctttaagcctgatttctgacgcgattgctcttggcatagaacaaaagccc
gatttgatattactgggcggcgattacgtattatttgatatgtcgctgaatttttcggcg
tttagtgacgtactctccccccttgccgaatgtgcgccgacgtttgcctgcttcggcaac
cacgatcgccctgttggtacagaaaaaaatcacttaattggcgagacgttgaaatcagcg
ggcatcacggtgttgtttaaccaggctacggtgatcgccacgccgaacaggcaattcgaa
ctggtaggcactggtgacttatgggccggacaatgcaaaccgcctcccgccagcgaagcc
aatctgccaagactggtgctggcgcataatcccgacagcaaagaagtcatgcgtgatgaa
ccctgggatctgatgctgtgcggccatactcacggcgggcaactgcgcgtaccgttggtt
ggtgaaccttttgcccctgtcgaagataaacgttacgtcgccggattaaatgcctttggc
gaaagacacatctacacaacccgtggcgtgggcagtttgtatggtttgcgtctgaactgc
cgcccggaagtaacgatgctggaactggtgtag

DBGET integrated database retrieval system