KEGG   Escherichia coli K-12 MG1655: b0166
Entry
b0166             CDS       T00007                                 

Gene name
dapD
Definition
(RefSeq) tetrahydrodipicolinate succinylase
  KO
K00674  2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase [EC:2.3.1.117]
Organism
eco  Escherichia coli K-12 MG1655
Pathway
eco00300  Lysine biosynthesis
eco01100  Metabolic pathways
eco01120  Microbial metabolism in diverse environments
eco01230  Biosynthesis of amino acids
Module
eco_M00016  Lysine biosynthesis, succinyl-DAP pathway, aspartate => lysine
Brite
KEGG Orthology (KO) [BR:eco00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00300 Lysine biosynthesis
    b0166 (dapD)
Enzymes [BR:eco01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.117  2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
     b0166 (dapD)
SSDB
Motif
Pfam: THDPS_N_2 Hexapep_2 Hexapep Cas3_C
Other DBs
NCBI-GeneID: 944862
NCBI-ProteinID: NP_414708
Pasteur: dapD
RegulonDB: ECK120000201
ECOCYC: EG10207
ASAP: ABE-0000565
UniProt: P0A9D8
Structure
PDB: 
3BXY

Position
complement(185123..185947)
AA seq 274 aa
MQQLQNIIETAFERRAEITPANADTVTREAVNQVIALLDSGALRVAEKIDGQWVTHQWLK
KAVLLSFRINDNQVIEGAESRYFDKVPMKFADYDEARFQKEGFRVVPPAAVRQGAFIARN
TVLMPSYVNIGAYVDEGTMVDTWATVGSCAQIGKNVHLSGGVGIGGVLEPLQANPTIIED
NCFIGARSEVVEGVIVEEGSVISMGVYIGQSTRIYDRETGEIHYGRVPAGSVVVSGNLPS
KDGKYSLYCAVIVKKVDAKTRGKVGINELLRTID
NT seq 825 nt   +upstreamnt  +downstreamnt
atgcagcagttacagaacattattgaaaccgcttttgaacgccgtgccgagatcacgcca
gccaatgcagacaccgttacccgcgaagcggtaaatcaggtgatcgccctgctggattcc
ggcgcactgcgtgtagcggaaaaaattgacggtcagtgggtgacgcatcagtggttgaaa
aaagcggtgctgctctctttccgtattaatgataatcaggtgatcgaaggggcagaaagc
cgctacttcgacaaagtgccgatgaaattcgccgactacgacgaagcacgtttccagaaa
gaaggcttccgcgttgtgccaccagcggcggtacgtcagggtgcgtttattgcccgtaac
accgtgctgatgccgtcttacgtcaacatcggcgcatatgttgatgaaggcaccatggtt
gatacctgggcgaccgtcggttcttgtgcgcagattggtaaaaacgtccacctttccggt
ggcgtgggcatcggcggcgtgctggaaccgctgcaggctaacccaaccatcattgaagat
aattgcttcatcggcgcgcgctctgaagtggttgaaggggtgattgtcgaagaaggttcc
gtcatttccatgggcgtatacattggtcagagcacccgtatttacgaccgtgaaaccggc
gaaatccactacggtcgcgttccggcggggtctgtggttgtttcaggtaatctgccgtca
aaagatggcaaatacagcctctactgtgcggttatcgttaagaaagttgacgcgaaaact
cgcggcaaagtcggcattaacgaactgctgcgtaccatcgactaa

DBGET integrated database retrieval system