KEGG   Escherichia coli K-12 MG1655: b0172
Entry
b0172             CDS       T00007                                 

Gene name
frr
Definition
(RefSeq) ribosome-recycling factor
  KO
K02838  ribosome recycling factor
Organism
eco  Escherichia coli K-12 MG1655
Brite
KEGG Orthology (KO) [BR:eco00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:eco03012]
    b0172 (frr)
Translation factors [BR:eco03012]
 Eukaryotic type
  Release factors
   b0172 (frr)
 Prokaryotic type
   b0172 (frr)
SSDB
Motif
Pfam: RRF LPP20
Other DBs
NCBI-GeneID: 946122
NCBI-ProteinID: NP_414714
Pasteur: frr
RegulonDB: ECK120000329
ECOCYC: EG10335
ASAP: ABE-0000588
UniProt: P0A805
Structure
PDB: 

Position
192872..193429
AA seq 185 aa
MISDIRKDAEVRMDKCVEAFKTQISKIRTGRASPSLLDGIVVEYYGTPTPLRQLASVTVE
DSRTLKINVFDRSMSPAVEKAIMASDLGLNPNSAGSDIRVPLPPLTEERRKDLTKIVRGE
AEQARVAVRNVRRDANDKVKALLKDKEISEDDDRRSQDDVQKLTDAAIKKIEAALADKEA
ELMQF
NT seq 558 nt   +upstreamnt  +downstreamnt
gtgattagcgatatcagaaaagatgctgaagtacgcatggacaaatgcgtagaagcgttc
aaaacccaaatcagcaaaatacgcacgggtcgtgcttctcccagcctgctggatggcatt
gtcgtggaatattacggcacgccgacgccgctgcgtcagctggcaagcgtaacggtagaa
gattcccgtacactgaaaatcaacgtgtttgatcgttcaatgtctccggccgttgaaaaa
gcgattatggcgtccgatcttggcctgaacccgaactctgcgggtagcgacatccgtgtt
ccgctgccgccgctgacggaagaacgtcgtaaagatctgaccaaaatcgttcgtggtgaa
gcagaacaagcgcgtgttgcagtacgtaacgtgcgtcgtgacgcgaacgacaaagtgaaa
gcactgttgaaagataaagagatcagcgaagacgacgatcgccgttctcaggacgatgta
cagaaactgactgatgctgcaatcaagaaaattgaagcggcgctggcagacaaagaagca
gaactgatgcagttctga

DBGET integrated database retrieval system