KEGG   Escherichia coli K-12 MG1655: b0183Help
Entry
b0183             CDS       T00007                                 

Gene name
rnhB
Definition
(RefSeq) RNase HII
  KO
K03470  ribonuclease HII [EC:3.1.26.4]
Organism
eco  Escherichia coli K-12 MG1655
Pathway
eco03030  DNA replication
Brite
KEGG Orthology (KO) [BR:eco00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    b0183 (rnhB)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:eco03032]
    b0183 (rnhB)
Enzymes [BR:eco01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.26  Endoribonucleases producing 5'-phosphomonoesters
    3.1.26.4  ribonuclease H
     b0183 (rnhB)
DNA replication proteins [BR:eco03032]
 Prokaryotic Type
  DNA Replication Elongation Factors
   Elongation factors (bacterial)
    RNase H
     b0183 (rnhB)
   Elongation factors (archaeal)
     b0183 (rnhB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RNase_HII
Motif
Other DBs
NCBI-GeneID: 944852
NCBI-ProteinID: NP_414725
Pasteur: rnhB
RegulonDB: ECK120000852
ECOCYC: EG10861
ASAP: ABE-0000622
UniProt: P10442 A0A387CVH9
Position
204493..205089
Genome map
AA seq 198 aa AA seqDB search
MIEFVYPHTQLVAGVDEVGRGPLVGAVVTAAVILDPARPIAGLNDSKKLSEKRRLALYEE
IKEKALSWSLGRAEPHEIDELNILHATMLAMQRAVAGLHIAPEYVLIDGNRCPKLPMPAM
AVVKGDSRVPEISAASILAKVTRDAEMAALDIVFPQYGFAQHKGYPTAFHLEKLAEHGAT
EHHRRSFGPVKRALGLAS
NT seq 597 nt NT seq  +upstreamnt  +downstreamnt
atgatcgaatttgtttatccgcacacgcagctggttgcgggtgtggatgaagtcggacgc
gggccgttagttggcgcggtcgtcaccgctgcggtgatccttgacccggcgcgcccgatt
gccgggctgaatgattccaaaaagctgagcgaaaaacgccgtctggcgctctatgaagag
atcaaagagaaagcgttgagctggagtctgggccgcgcggaaccccacgaaatcgacgag
ctgaacattcttcatgcgaccatgctggcgatgcagcgtgccgtcgctgggctgcatatt
gcgccggaatatgtgttgattgatggtaaccgctgcccgaaattaccgatgcctgcgatg
gctgtggtgaaaggcgatagccgcgtaccggaaatcagtgccgcgtctatcctggcgaaa
gtgacgcgtgacgccgaaatggcggcgctggatattgttttcccgcaatatggttttgcc
caacacaaagggtacccaaccgcttttcatctggaaaaactggctgaacacggcgcgacc
gaacaccatcggcgcagctttgggcctgtcaaacgcgcactgggacttgcgtcctga

DBGET integrated database retrieval system