KEGG   Escherichia coli K-12 MG1655: b0215Help
Entry
b0215             CDS       T00007                                 

Gene name
dnaQ
Definition
(RefSeq) DNA polymerase III subunit epsilon
  KO
K02342  DNA polymerase III subunit epsilon [EC:2.7.7.7]
Organism
eco  Escherichia coli K-12 MG1655
Pathway
eco03030  DNA replication
eco03430  Mismatch repair
eco03440  Homologous recombination
Module
eco_M00260  DNA polymerase III complex, bacteria
Brite
KEGG Orthology (KO) [BR:eco00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    b0215 (dnaQ)
   03430 Mismatch repair
    b0215 (dnaQ)
   03440 Homologous recombination
    b0215 (dnaQ)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:eco03032]
    b0215 (dnaQ)
   03400 DNA repair and recombination proteins [BR:eco03400]
    b0215 (dnaQ)
Enzymes [BR:eco01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     b0215 (dnaQ)
DNA replication proteins [BR:eco03032]
 Prokaryotic Type
  DNA Replication Elongation Factors
   Elongation factors (bacterial)
    DNA polymerase III holoenzyme
     b0215 (dnaQ)
DNA repair and recombination proteins [BR:eco03400]
 Prokaryotic Type
  SSBR (single strand breaks repair)
   MMR (mismatch excision repair)
    DNA polymerase III holoenzyme
     b0215 (dnaQ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RNase_T DUF5051 DNA_pol_A_exo1 vATP-synt_AC39
Motif
Other DBs
NCBI-GeneID: 946441
NCBI-ProteinID: NP_414751
Pasteur: dnaQ
RegulonDB: ECK120000237
ECOCYC: EG10243
ASAP: ABE-0000722
UniProt: P03007 A0A387D1X8
Structure
PDB: 

Position
236067..236798
Genome map
AA seq 243 aa AA seqDB search
MSTAITRQIVLDTETTGMNQIGAHYEGHKIIEIGAVEVVNRRLTGNNFHVYLKPDRLVDP
EAFGVHGIADEFLLDKPTFAEVADEFMDYIRGAELVIHNAAFDIGFMDYEFSLLKRDIPK
TNTFCKVTDSLAVARKMFPGKRNSLDALCARYEIDNSKRTLHGALLDAQILAEVYLAMTG
GQTSMAFAMEGETQQQQGEATIQRIVRQASKLRVVFATDEEIAAHEARLDLVQKKGGSCL
WRA
NT seq 732 nt NT seq  +upstreamnt  +downstreamnt
atgagcactgcaattacacgccagatcgttctcgataccgaaaccaccggtatgaaccag
attggtgcgcactatgaaggccacaagatcattgagattggtgccgttgaagtggtgaac
cgtcgcctgacgggcaataacttccatgtttatctcaaacccgatcggctggtggatccg
gaagcctttggcgtacatggtattgccgatgaatttttgctcgataagcccacgtttgcc
gaagtagccgatgagttcatggactatattcgcggcgcggagttggtgatccataacgca
gcgttcgatatcggctttatggactacgagttttcgttgcttaagcgcgatattccgaag
accaatactttctgtaaggtcaccgatagccttgcggtggcgaggaaaatgtttcccggt
aagcgcaacagcctcgatgcgttatgtgctcgctacgaaatagataacagtaaacgaacg
ctgcacggggcattactcgatgcccagatccttgcggaagtttatctggcgatgaccggt
ggtcaaacgtcgatggcttttgcgatggaaggagagacacaacagcaacaaggtgaagca
acaattcagcgcattgtacgtcaggcaagtaagttacgcgttgtttttgcgacagatgaa
gagattgcagctcatgaagcccgtctcgatctggtgcagaagaaaggcggaagttgcctc
tggcgagcataa

DBGET integrated database retrieval system