KEGG   Escherichia coli K-12 MG1655: b0222Help
Entry
b0222             CDS       T00007                                 

Gene name
gmhA
Definition
(RefSeq) D-sedoheptulose 7-phosphate isomerase
  KO
K03271  D-sedoheptulose 7-phosphate isomerase [EC:5.3.1.28]
Organism
eco  Escherichia coli K-12 MG1655
Pathway
eco00540  Lipopolysaccharide biosynthesis
eco01100  Metabolic pathways
Module
eco_M00064  ADP-L-glycero-D-manno-heptose biosynthesis
Brite
KEGG Orthology (KO) [BR:eco00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00540 Lipopolysaccharide biosynthesis
    b0222 (gmhA)
Enzymes [BR:eco01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.28  D-sedoheptulose 7-phosphate isomerase
     b0222 (gmhA)
Lipopolysaccharide biosynthesis proteins [BR:eco01005]
 Unusual sugar
  b0222 (gmhA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SIS_2 SIS Antibiotic_NAT
Motif
Other DBs
NCBI-GeneID: 949134
NCBI-ProteinID: NP_414757
Pasteur: lpcA
RegulonDB: ECK120002726
ASAP: ABE-0000751
UniProt: P63224
Structure
PDB: 

Position
243543..244121
Genome map
AA seq 192 aa AA seqDB search
MYQDLIRNELNEAAETLANFLKDDANIHAIQRAAVLLADSFKAGGKVLSCGNGGSHCDAM
HFAEELTGRYRENRPGYPAIAISDVSHISCVGNDFGFNDIFSRYVEAVGREGDVLLGIST
SGNSANVIKAIAAAREKGMKVITLTGKDGGKMAGTADIEIRVPHFGYADRIQEIHIKVIH
ILIQLIEKEMVK
NT seq 579 nt NT seq  +upstreamnt  +downstreamnt
atgtaccaggatcttattcgtaacgaactgaacgaagcggcggaaacgctggctaacttt
ttaaaagatgacgccaatattcacgccattcagcgcgcggcggtcctgttagcagacagc
tttaaagccggtggcaaagtgctttcctgcggcaacggcggttcccattgcgacgctatg
cactttgccgaagagttgaccggtcgctaccgtgaaaaccgtccgggctacccggcgatt
gctatttctgacgttagtcatatttcctgcgtcggtaatgatttcggtttcaatgatatt
ttctcccgctacgttgaagcggtaggtcgcgaaggcgatgtactgctggggatctccacc
tccggtaactctgcaaacgtgatcaaagcgatcgcagcggcgcgtgagaagggaatgaaa
gtgatcaccctgaccggtaaagacggcggcaaaatggctggcacggcggatatcgaaatt
cgcgtaccgcactttggttatgccgaccgcattcaggagattcacattaaagtgatccat
atcctgatccagttgattgaaaaagagatggttaagtaa

DBGET integrated database retrieval system