KEGG   Escherichia coli K-12 MG1655: b0260Help
Entry
b0260             CDS       T00007                                 

Gene name
mmuP
Definition
(RefSeq) CP4-6 prophage; putative S-methylmethionine transporter
  KO
K16235  S-methylmethionine transporter
Organism
eco  Escherichia coli K-12 MG1655
Brite
Transporters [BR:eco02000]
 Other Transporters
  Electrochemical potential-driven transporters [TC:2]
   b0260 (mmuP)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AA_permease AA_permease_2 DUF4131 Trp_oprn_chp
Motif
Other DBs
NCBI-GeneID: 946284
NCBI-ProteinID: NP_414794
RegulonDB: ECK120002755
ECOCYC: G6135
ASAP: ABE-0000893
UniProt: Q47689
Position
275325..276728
Genome map
AA seq 467 aa AA seqDB search
MQTTQQNAPLKRTMKTRHLIMLSLGGVIGTGLFFNTGYIISTTGAAGTLLAYLIGALVVW
LVMQCLGELSVAMPETGAFHVYAARYLGPATGYTVAWLYWLTWTVALGSSFTAAGFCMQY
WFPQVPVWVWCVVFCAIIFGLNVISTRFFAEGEFWFSLVKVVTIIAFIILGGAAIFGFIP
MQDGSPAPGLSNITAEGWFPHGGLPILMTMVAVNFAFSGTELIGIAAGETENPRKVIPVA
IRTTIARLIIFFIGTVFVLAALIPMQQVGVEKSPFVLVFEKVGIPYAADIFNFVILTAIL
SAANSGLYASGRMLWSLSNERTLPACFARVTKNGVPLTALSVSMLGGVLALFSSVVAPDT
VFVALSAISGFAVVAVWLSICASHFVFRRRHLQQGKALSELHYRAPWYPLVPVLGFVLCL
VACVGLAFDPAQRIALWCGLPFVALCYGAYFLTQPRNAKQEPEHVAE
NT seq 1404 nt NT seq  +upstreamnt  +downstreamnt
atgcaaacaacacaacaaaatgcgccactgaagcgcacaatgaaaacgcgtcacctgatt
atgctttccttgggcggcgtgattggcacaggattattcttcaataccgggtacatcatt
tccaccactggagcggcgggaacgctgctggcctatctgattggtgcgctggtggtctgg
ctggttatgcagtgtctgggcgagctgtcggtcgcgatgccggagaccggagcgtttcac
gtttatgccgcgcgctatcttggtccggctaccgggtataccgtggcctggctttactgg
ctgacctggaccgtggcgctgggttcgagctttaccgccgctggattctgtatgcagtac
tggtttccacaggtgccggtatgggtctggtgcgtggtgttctgcgcgattatttttggt
ctgaatgttatctccacgcgcttttttgccgaaggggagttctggttctcgctggtcaaa
gtggtcactatcatcgcctttatcatcctcggtggggcggcgattttcggctttattccg
atgcaggatggctcgcccgcgccggggctgagtaatatcacggcagaaggctggttcccg
cacggtggcttaccgattttgatgactatggtggcagtgaactttgctttttcgggtacc
gagcttatcggcattgccgccggtgaaacggaaaacccgcgcaaagttatcccggtagcg
attcgtactaccatcgcgcgactgattattttctttatcggcaccgtgtttgtgctggca
gcgctgatcccgatgcagcaggtgggcgtggagaaaagcccgtttgtgctggtatttgag
aaagtagggatcccgtacgccgctgatatttttaacttcgtgatcctgacggctattctt
tctgcagcgaactccgggttatatgcctccgggcgcatgctgtggtcgttgtcgaatgaa
cgtacgctaccggcctgttttgcgcgagtaacgaaaaacggcgtgccactgacggcgctg
tcggtcagtatgctcggtggtgtgctggcgctgttttccagcgtggtggccccggacacg
gtatttgttgcgctgtcggcaatctccgggtttgcggtggtagcggtgtggctgagtatc
tgcgcctcgcattttgtttttcgtcgccgtcatctgcaacaaggtaaggcattgagtgaa
ttacattatcgcgcgccgtggtatccgctggtgccagtattaggttttgtgctgtgcctg
gtggcctgtgttgggctggcattcgatccagcgcagagaattgcgttgtggtgcgggtta
ccgtttgttgcgttgtgctatggtgcttatttccttactcaaccccgaaacgcaaaacag
gagccagaacatgtcgcagaataa

DBGET integrated database retrieval system