KEGG   Escherichia coli K-12 MG1655: b0314Help
Entry
b0314             CDS       T00007                                 

Gene name
betT
Definition
(RefSeq) choline:H(+) symporter
  KO
K02168  choline/glycine/proline betaine transport protein
Organism
eco  Escherichia coli K-12 MG1655
Brite
KEGG Orthology (KO) [BR:eco00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:eco02000]
    b0314 (betT)
Transporters [BR:eco02000]
 Other Transporters
  Electrochemical potential-driven transporters [TC:2]
   b0314 (betT)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: BCCT
Motif
Other DBs
NCBI-GeneID: 945079
NCBI-ProteinID: NP_414848
Pasteur: betT
RegulonDB: ECK120000108
ECOCYC: EG10112
ASAP: ABE-0001080
UniProt: P0ABC9 A0A387D1E8
Position
329463..331496
Genome map
AA seq 677 aa AA seqDB search
MTDLSHSREKDKINPVVFYTSAGLILLFSLTTILFRDFSALWIGRTLDWVSKTFGWYYLL
AATLYIVFVVCIACSRFGSVKLGPEQSKPEFSLLSWAAMLFAAGIGIDLMFFSVAEPVTQ
YMQPPEGAGQTIEAARQAMVWTLFHYGLTGWSMYALMGMALGYFSYRYNLPLTIRSALYP
IFGKRINGPIGHSVDIAAVIGTIFGIATTLGIGVVQLNYGLSVLFDIPDSMAAKAALIAL
SVIIATISVTSGVDKGIRVLSELNVALALGLILFVLFMGDTSFLLNALVLNVGDYVNRFM
GMTLNSFAFDRPVEWMNNWTLFFWAWWVAWSPFVGLFLARISRGRTIRQFVLGTLIIPFT
FTLLWLSVFGNSALYEIIHGGAAFAEEAMVHPERGFYSLLAQYPAFTFSASVATITGLLF
YVTSADSGALVLGNFTSQLKDINSDAPGWLRVFWSVAIGLLTLGMLMTNGISALQNTTVI
MGLPFSFVIFFVMAGLYKSLKVEDYRRESANRDTAPRPLGLQDRLSWKKRLSRLMNYPGT
RYTKQMMETVCYPAMEEVAQELRLRGAYVELKSLPPEEGQQLGHLDLLVHMGEEQNFVYQ
IWPQQYSVPGFTYRARSGKSTYYRLETFLLEGSQGNDLMDYSKEQVITDILDQYERHLNF
IHLHREAPGHSVMFPDA
NT seq 2034 nt NT seq  +upstreamnt  +downstreamnt
atgacagacctttcacacagcagggaaaaggacaaaatcaatccggtggtgttttacacc
tccgccggactgattttgttgttttccctgacaacgatcctgtttcgcgacttctcggcc
ctgtggattggccgcacgctggactgggtttctaaaaccttcggttggtactatctgctg
gcggcaacgctctatattgtctttgtggtctgtatcgcttgttcgcgttttggttcggtg
aagctcgggccagaacaatccaaaccggaattcagcctgctgagttgggcggcgatgctg
tttgctgccgggatcggtatcgacctgatgttcttctccgtagccgaaccggtaacgcag
tatatgcagccgccggaaggcgcgggacagacgattgaggccgcgcgtcaggcgatggtc
tggacgctgtttcactacggcttaaccggctggtcgatgtatgcgctgatgggcatggcg
ctcggatactttagctatcgttataatttgccgctcaccatccgctcggcgctgtacccg
atcttcggtaaacggattaacgggccgataggtcactcagtggatattgcagcggtgatc
ggcactatcttcggtattgccactacgctcggtatcggtgtggtgcagcttaactatggc
ttgagcgtactgtttgatattcccgattcgatggcggcgaaagcggcactgatcgccttg
tcggtgataatcgccacgatctctgtcacctccggtgtcgataagggcattcgcgtgtta
tcggagcttaatgtcgcgctggcgctgggattgatcctgttcgtattgtttatgggcgac
acttcgttcctgcttaatgcactggtgctgaatgttggcgactatgtgaatcgctttatg
ggcatgacgctcaacagttttgccttcgaccgtccggttgagtggatgaataactggacg
ctcttcttctgggcatggtgggtggcatggtcgccgtttgtcggcttgttcctggcgcgt
atctcgcgtgggcgtaccattcgccagttcgtgctgggcacgttgattattccgtttacc
ttcacgctgttatggctctcggtgttcggcaatagcgcgctgtatgaaatcatccacggc
ggcgcggcatttgccgaggaagcgatggtccatccggagcgcggcttctacagcctgctg
gcgcagtatccggcgtttacctttagcgcctccgtcgccaccattactggcctgctgttt
tatgtgacctcggcggactccggggcgctggtgctggggaatttcacctcgcagcttaaa
gatatcaacagcgacgcccccggctggctgcgcgtcttctggtcggtggcgattggcctg
ctgacgctcggcatgctgatgactaacgggatatccgcgctgcaaaacaccacggtgatt
atggggctgccgttcagctttgtgatcttcttcgtgatggcggggttgtataaatctctg
aaggtagaagattaccgccgtgaaagtgccaaccgcgataccgcaccgcgaccgctgggg
cttcaggatcgcctgagctggaaaaaacgtctctcgcgcctgatgaattatccgggcacg
cgttacactaaacagatgatggagacggtctgttacccggcaatggaagaagtggcgcag
gagttgcggttgcgcggcgcgtacgtggagctaaaaagcctgccaccggaagagggacag
cagttgggtcatctggatttgttggtgcatatgggcgaagagcaaaactttgtctatcag
atttggccgcagcaatattcggtgccgggctttacctaccgcgcacgcagcggtaaatcg
acctactaccggctggaaaccttcctgttagaaggcagccagggcaacgacctgatggac
tacagcaaagagcaggtgatcaccgatattcttgaccagtacgagcggcaccttaacttt
attcatctccatcgtgaagcgccgggccatagcgtgatgttcccggacgcgtga

DBGET integrated database retrieval system