KEGG   Escherichia coli K-12 MG1655: b0328
Entry
b0328             CDS       T00007                                 

Gene name
yahN
Definition
(RefSeq) putative amino acid exporter
  KO
K03329  amino acid exporter
Organism
eco  Escherichia coli K-12 MG1655
Brite
KEGG Orthology (KO) [BR:eco00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:eco02000]
    b0328 (yahN)
Transporters [BR:eco02000]
 Other transporters
  Electrochemical potential-driven transporters [TC:2]
   b0328 (yahN)
Motif
Pfam: LysE TerC
Other DBs
NCBI-GeneID: 944968
NCBI-ProteinID: NP_414862
Pasteur: yahN
RegulonDB: ECK120002811
ECOCYC: G6193
ASAP: ABE-0001122
UniProt: P75693
Position
complement(345666..346337)
AA seq 223 aa
MMQLVHLFMDEITMDPLHAVYLTVGLFVITFFNPGANLFVVVQTSLASGRRAGVLTGLGV
ALGDAFYSGLGLFGLATLITQCEEIFSLIRIVGGAYLLWFAWCSMRRQSTPQMSTLQQPI
SAPWYVFFRRGLITDLSNPQTVLFFISIFSVTLNAETPTWARLMAWAGIVLASIIWRVFL
SQAFSLPAVRRAYGRMQRVASRVIGAIIGVFALRLIYEGVTQR
NT seq 672 nt   +upstreamnt  +downstreamnt
atgatgcagttagttcacttatttatggatgaaatcactatggatcctttgcatgccgtt
tacctgaccgtaggactgttcgtgattactttttttaatccgggagccaatctctttgtg
gtagtacaaaccagcctggcttccggtcgacgcgcaggggtgctgaccgggctgggcgtg
gcgctgggcgatgcattttattccgggttgggtttgtttggtcttgcaacgctaattacg
cagtgtgaggagattttttcgcttatcagaatcgtcggcggcgcttatctcttatggttt
gcgtggtgcagcatgcgccgccagtcaacaccgcaaatgagcacactacaacaaccgatt
agcgccccctggtatgtcttttttcgccgcggattaattaccgatctctctaacccgcaa
accgttttattttttatcagtattttctcagtaacattaaatgccgaaacaccaacatgg
gcacgtttaatggcctgggcggggattgtgctcgcatcaattatctggcgagtttttctt
agtcaggcgttttctttgcccgctgtgcgtcgtgcttatgggcgtatgcaacgcgttgcc
agtcgggttattggtgcaattattggtgtattcgcgctacgcctgatttacgaaggggtg
acgcagcggtga

DBGET integrated database retrieval system