KEGG   Escherichia coli K-12 MG1655: b0353Help
Entry
b0353             CDS       T00007                                 

Gene name
mhpT
Definition
(RefSeq) 3-hydroxyphenylpropionate/3-hydroxycinnamate:H(+) symporter
  KO
K05819  MFS transporter, AAHS family, 3-hydroxyphenylpropionic acid transporter
Organism
eco  Escherichia coli K-12 MG1655
Brite
KEGG Orthology (KO) [BR:eco00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:eco02000]
    b0353 (mhpT)
Transporters [BR:eco02000]
 Major facilitator superfamily (MFS)
  Organic acid transporters
   Aromatic acid:H+ symporter (AAHS) family [TC:2.A.1.15]
    b0353 (mhpT)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MFS_1 Sugar_tr MFS_4 MFS_Mycoplasma
Motif
Other DBs
NCBI-GeneID: 944997
NCBI-ProteinID: NP_414887
Pasteur: mhpT
RegulonDB: ECK120002820
ECOCYC: G6206
ASAP: ABE-0001213
UniProt: P77589
Position
375459..376670
Genome map
AA seq 403 aa AA seqDB search
MSTRTPSSSSSRLMLTIGLCFLVALMEGLDLQAAGIAAGGIAQAFALDKMQMGWIFSAGI
LGLLPGALVGGMLADRYGRKRILIGSVALFGLFSLATAIAWDFPSLVFARLMTGVGLGAA
LPNLIALTSEAAGPRFRGTAVSLMYCGVPIGAALAATLGFAGANLAWQTVFWVGGVVPLI
LVPLLMRWLPESAVFAGEKQSAPPLRALFAPETATATLLLWLCYFFTLLVVYMLINWLPL
LLVEQGFQPSQAAGVMFALQMGAASGTLMLGALMDKLRPVTMSLLIYSGMLASLLALGTV
SSFNGMLLAGFVAGLFATGGQSVLYALAPLFYSSQIRATGVGTAVAVGRLGAMSGPLLAG
KMLALGTGTVGVMAASAPGILVAGLAVFILMSRRSRIQPCADA
NT seq 1212 nt NT seq  +upstreamnt  +downstreamnt
atgtcgactcgtaccccttcatcatcttcatcccgcctgatgctgaccatcgggctttgt
tttttggtcgctctgatggaagggctggatcttcaggcggctggcattgcggcgggtggc
atcgcccaggctttcgcactcgataaaatgcaaatgggctggatatttagcgccggaata
ctcggtttgctacccggcgcgttggttggcggaatgctggcggaccgttatggtcgcaag
cgcattttgattggctcagttgcgctgtttggtttgttctcactggcaacggcgattgcc
tgggatttcccctcactggtctttgcgcggctgatgaccggtgtcgggctgggggcggcg
ttgccgaatcttatcgccctgacgtctgaagccgcgggtccacgttttcgtgggacggca
gtgagcctgatgtattgcggtgttcccattggcgcggcgctggcggcgacactgggtttc
gcgggggcaaacttagcatggcaaacggtgttttgggtaggtggtgtggtgccgttgatt
ctggtgccgctattaatgcgctggctgccggagtcggcggttttcgctggcgaaaaacag
tctgcgccaccactgcgtgccttatttgcgccagaaacggcaaccgcgacgctgctgctg
tggttgtgttatttcttcactctgctggtggtctacatgttgatcaactggctaccgcta
cttttggtggagcaaggattccagccatcgcaggcggcaggggtgatgtttgccctgcaa
atgggggcggcaagcgggacgttaatgttgggcgcattgatggataagctgcgtccagta
accatgtcgctactgatttatagcggcatgttagcttcgctgctggcgcttggaacggtg
tcgtcatttaacggtatgttgctggcgggatttgtcgcggggttgtttgcgacaggtggg
caaagcgttttgtatgccctggcaccgttgttttacagttcgcagatccgcgcaacaggt
gtgggaacagccgtggcggtagggcgtctgggggctatgagcggtccgttactggccggg
aaaatgctggcattaggcactggcacggtcggcgtaatggccgcttctgcaccgggtatt
cttgttgctgggttggcggtgtttattttgatgagccggagatcacgaatacagccgtgc
gccgatgcctga

DBGET integrated database retrieval system