KEGG   Escherichia coli K-12 MG1655: b0354
Entry
b0354             CDS       T00007                                 

Gene name
yaiL
Definition
(RefSeq) DUF2058 domain-containing protein YaiL
  KO
K09912  uncharacterized protein
Organism
eco  Escherichia coli K-12 MG1655
Brite
KEGG Orthology (KO) [BR:eco00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99997 Function unknown
    b0354 (yaiL)
SSDB
Motif
Pfam: DUF2058 Dynactin_p62
Other DBs
NCBI-GeneID: 944993
NCBI-ProteinID: NP_414888
Pasteur: yaiL
RegulonDB: ECK120002821
ECOCYC: G6207
ASAP: ABE-0001216
UniProt: P51024
Position
376772..377311
AA seq 179 aa
MAKLTLQEQLLKAGLVTSKKAAKVERTAKKSRVQAREARAAVEENKKAQLERDKQLSEQQ
KQAALAKEYKAQVKQLIEMNRITIANGDIGFNFTDGNLIKKIFVDKLTQAQLINGRLAIA
RLLVDNNSEGEYAIIPASVADKIAQRDASSIVLHSALSAEEQDEDDPYADFKVPDDLMW
NT seq 540 nt   +upstreamnt  +downstreamnt
atggcaaaacttaccttacaagagcagttgctcaaagcaggattagtcaccagcaaaaaa
gcggcgaaggtggagagaacggcgaaaaaatcgcgcgttcaggcgcgtgaagctcgggcg
gcggtagaagaaaataaaaaggcacagcttgagcgtgataaacagcttagcgaacagcaa
aaacaagcggcgttggcgaaagaatataaagctcaggtgaagcagcttattgaaatgaac
cgaatcaccattgccaatggcgatattggttttaacttcactgacggcaatctgattaag
aagatttttgtcgataagctcacacaggcgcagttgattaatggtcgtctggcgattgcc
cgcttgttggtcgataacaatagcgaaggtgaatacgccattattcccgccagcgttgcc
gataaaattgctcagcgcgatgccagcagtatagtgttgcacagcgcgctcagcgccgaa
gagcaggatgaagacgacccgtatgccgacttcaaagtgcctgatgatttgatgtggtaa

DBGET integrated database retrieval system