KEGG   Escherichia coli K-12 MG1655: b0356Help
Entry
b0356             CDS       T00007                                 

Gene name
frmA
Definition
(RefSeq) S-(hydroxymethyl)glutathione dehydrogenase
  KO
K00121  S-(hydroxymethyl)glutathione dehydrogenase / alcohol dehydrogenase [EC:1.1.1.284 1.1.1.1]
Organism
eco  Escherichia coli K-12 MG1655
Pathway
eco00010  Glycolysis / Gluconeogenesis
eco00071  Fatty acid degradation
eco00350  Tyrosine metabolism
eco00625  Chloroalkane and chloroalkene degradation
eco00626  Naphthalene degradation
eco00680  Methane metabolism
eco01100  Metabolic pathways
eco01110  Biosynthesis of secondary metabolites
eco01120  Microbial metabolism in diverse environments
eco01130  Biosynthesis of antibiotics
eco01200  Carbon metabolism
eco01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:eco00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    b0356 (frmA)
  09102 Energy metabolism
   00680 Methane metabolism
    b0356 (frmA)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    b0356 (frmA)
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    b0356 (frmA)
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    b0356 (frmA)
   00626 Naphthalene degradation
    b0356 (frmA)
Enzymes [BR:eco01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     b0356 (frmA)
    1.1.1.284  S-(hydroxymethyl)glutathione dehydrogenase
     b0356 (frmA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N ADH_zinc_N_2 TrkA_N MinC_C 2-Hacid_dh_C Met_10 ADH_N_2
Motif
Other DBs
NCBI-GeneID: 944988
NCBI-ProteinID: NP_414890
Pasteur: adhC
RegulonDB: ECK120002569
ECOCYC: EG50010
ASAP: ABE-0001221
UniProt: P25437
Position
complement(378462..379571)
Genome map
AA seq 369 aa AA seqDB search
MKSRAAVAFAPGKPLEIVEIDVAPPKKGEVLIKVTHTGVCHTDAFTLSGDDPEGVFPVVL
GHEGAGVVVEVGEGVTSVKPGDHVIPLYTAECGECEFCRSGKTNLCVAVRETQGKGLMPD
GTTRFSYNGQPLYHYMGCSTFSEYTVVAEVSLAKINPEANHEHVCLLGCGVTTGIGAVHN
TAKVQPGDSVAVFGLGAIGLAVVQGARQAKAGRIIAIDTNPKKFDLARRFGATDCINPND
YDKPIKDVLLDINKWGIDHTFECIGNVNVMRAALESAHRGWGQSVIIGVAVAGQEISTRP
FQLVTGRVWKGSAFGGVKGRSQLPGMVEDAMKGDIDLEPFVTHTMSLDEINDAFDLMHEG
KSIRTVIRY
NT seq 1110 nt NT seq  +upstreamnt  +downstreamnt
atgaaatcacgtgctgccgttgcatttgctcccggtaaaccgctggaaatcgttgaaatt
gacgttgcaccaccgaaaaaaggtgaagtgctaattaaagtcacccataccggcgtttgc
cataccgacgcatttaccctctccggcgatgacccggaaggtgtattcccggtggttctc
ggtcacgaaggggccggcgttgtggttgaagtcggtgaaggcgtaaccagcgtcaaacct
ggcgaccatgtgatcccgctttacaccgcggagtgcggcgagtgtgagttctgtcgttct
ggcaaaactaacctctgtgttgcggttcgcgaaacccagggtaaaggcctgatgccagac
ggcaccacccgtttttcttacaacgggcagccgctttatcactacatggggtgctctaca
ttcagtgaatacaccgtagtcgcggaagtgtctctggcaaaaattaatccagaagcaaac
catgaacacgtctgcctgctgggctgtggcgtgaccaccggtattggcgcggtacacaac
acagctaaagtccagccaggtgattctgttgccgtgtttggtcttggcgcgattggtctg
gcagtggttcagggcgcgcgtcaggcgaaagcgggtcggattatcgctatcgataccaac
ccgaagaaattcgatctggcgcgtcgcttcggtgctaccgactgcattaacccgaatgac
tacgacaaaccgataaaagatgtcctgttggatatcaacaaatggggtatcgaccatacc
tttgaatgcatcggtaacgtcaacgtgatgcgtgcggcgctggaaagtgcgcaccgcggc
tggggtcagtcggtgatcatcggggtcgcggttgccggtcaggaaatctccacccgtcca
ttccagttggtcactggtcgcgtatggaaaggttccgcgtttggcggcgtgaaaggtcgt
tcccagttaccgggcatggttgaagatgcgatgaaaggtgatatcgatctggaaccgttt
gtcacgcataccatgagcctggatgaaattaatgacgccttcgacctgatgcatgaaggc
aaatccattcgaaccgtaattcgttactga

DBGET integrated database retrieval system