KEGG   Escherichia coli K-12 MG1655: b0405
Entry
b0405             CDS       T00007                                 

Gene name
queA
Definition
(RefSeq) tRNA preQ1(34) S-adenosylmethionine ribosyltransferase-isomerase
  KO
K07568  S-adenosylmethionine:tRNA ribosyltransferase-isomerase [EC:2.4.99.17]
Organism
eco  Escherichia coli K-12 MG1655
Brite
KEGG Orthology (KO) [BR:eco00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:eco03016]
    b0405 (queA)
Enzymes [BR:eco01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.99  Transferring other glycosyl groups
    2.4.99.17  S-adenosylmethionine:tRNA ribosyltransferase-isomerase
     b0405 (queA)
Transfer RNA biogenesis [BR:eco03016]
 Prokaryotic type
  tRNA modification factors
   Other tRNA modification factors
    b0405 (queA)
SSDB
Motif
Pfam: Queuosine_synth
Other DBs
NCBI-GeneID: 944905
NCBI-ProteinID: NP_414939
Pasteur: queA
RegulonDB: ECK120000803
ECOCYC: EG10812
ASAP: ABE-0001411
UniProt: P0A7F9
Position
425011..426081
AA seq 356 aa
MRVTDFSFELPESLIAHYPMPERSSCRLLSLDGPTGALTHGTFTDLLDKLNPGDLLVFNN
TRVIPARLFGRKASGGKIEVLVERMLDDKRILAHIRASKAPKPGAELLLGDDESINATMT
ARHGALFEVEFNDERSVLDILNSIGHMPLPPYIDRPDEDADRELYQTVYSEKPGAVAAPT
AGLHFDEPLLEKLRAKGVEMAFVTLHVGAGTFQPVRVDTIEDHIMHSEYAEVPQDVVDAV
LAAKARGNRVIAVGTTSVRSLESAAQAAKNDLIEPFFDDTQIFIYPGFQYKVVDALVTNF
HLPESTLIMLVSAFAGYQHTMNAYKAAVEEKYRFFSYGDAMFITYNPQAINERVGE
NT seq 1071 nt   +upstreamnt  +downstreamnt
atgcgcgttaccgatttctcctttgaattgcccgaatccctgattgcccactatcccatg
cctgaacgcagtagctgtcgtttactgtcgctggacgggccgacgggcgcgctgacgcac
ggtactttcaccgatttacttgataagctcaaccccggcgatcttctggtttttaataat
acccgcgtgatcccggcgcgcctgtttgggcgtaaagccagcggcggcaagattgaagtg
ctggttgaacggatgctcgacgacaaacgcattcttgcgcatattcgcgcctcgaaagcg
ccaaaacctggcgcagaactgctgctgggcgatgacgaaagtattaacgcaacaatgacc
gcgcgccacggcgcactgtttgaagtcgaatttaatgatgaacgctcggtgctggatatt
ctcaacagcatcggccatatgccgctgccgccgtatatcgaccgtccggacgaagacgct
gaccgcgaactttatcaaaccgtttatagcgaaaaaccgggcgcggttgcagccccgacc
gcaggtctgcattttgacgagcctttgctggaaaaattgcgcgccaaaggcgtggagatg
gcgtttgtgacgttgcacgttggtgcgggcaccttccagccggtgcgcgtcgacaccatt
gaagatcacatcatgcactcggaatacgctgaagtaccgcaggatgtggtagacgcggta
ctggcggcgaaagcgcgcggtaaccgggtgattgcggttggcaccacttcagtacgttcg
ctggaaagcgcggctcaggcagcgaaaaacgatctcattgaaccgttcttcgacgatacc
caaatctttatctatccgggcttccagtacaaagtggtcgatgcgctggtgacgaacttc
cacttgccagagtcgacgctgattatgctggtttcggcctttgccggttatcaacacacc
atgaacgcctataaagcagcggtagaagagaaatatcgcttttttagttacggtgatgcg
atgtttatcacgtacaatccgcaggcaattaatgagcgcgtcggggagtaa

DBGET integrated database retrieval system