KEGG   Escherichia coli K-12 MG1655: b0410Help
Entry
b0410             CDS       T00007                                 

Gene name
yajD
Definition
(RefSeq) HNH nuclease family protein
Organism
eco  Escherichia coli K-12 MG1655
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HNH
Motif
Other DBs
NCBI-GeneID: 945051
NCBI-ProteinID: NP_414944
Pasteur: yajD
RegulonDB: ECK120001085
ECOCYC: EG11097
ASAP: ABE-0001422
UniProt: P0AAQ2
Position
430605..430952
Genome map
AA seq 115 aa AA seqDB search
MAIIPKNYARLESGYREKALKIYPWVCGRCSREFVYSNLRELTVHHIDHDHTNNPEDGSN
WELLCLYCHDHEHSKYTEADQYGTTVIAGEDAQKDVGEAKYNPFADLKAMMNKKK
NT seq 348 nt NT seq  +upstreamnt  +downstreamnt
atggctatcatcccaaaaaactatgcgcggttagaaagcggctatcgcgaaaaagcatta
aaaatctatccgtgggtctgcggtcgctgttcccgcgagtttgtttattccaacctgcgt
gaacttaccgttcaccacattgatcacgaccataccaataacccggaagatggcagtaac
tgggaattgttgtgtctctattgccacgatcatgagcattcgaaatataccgaagcggat
cagtatggtacgaccgttatcgcaggggaagatgcgcagaaagatgtcggtgaagcgaag
tacaacccattcgctgacctgaaagcgatgatgaacaagaagaagtga

DBGET integrated database retrieval system