KEGG   Escherichia coli K-12 MG1655: b0425Help
Entry
b0425             CDS       T00007                                 

Gene name
panE
Definition
(RefSeq) 2-dehydropantoate 2-reductase
  KO
K00077  2-dehydropantoate 2-reductase [EC:1.1.1.169]
Organism
eco  Escherichia coli K-12 MG1655
Pathway
eco00770  Pantothenate and CoA biosynthesis
eco01100  Metabolic pathways
eco01110  Biosynthesis of secondary metabolites
Module
eco_M00119  Pantothenate biosynthesis, valine/L-aspartate => pantothenate
Brite
KEGG Orthology (KO) [BR:eco00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    b0425 (panE)
Enzymes [BR:eco01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.169  2-dehydropantoate 2-reductase
     b0425 (panE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ApbA_C ApbA Rossmann-like NAD_Gly3P_dh_N ATP-cone F420_oxidored HbrB NAD_binding_2
Motif
Other DBs
NCBI-GeneID: 945065
NCBI-ProteinID: NP_414959
Pasteur: apbA
RegulonDB: ECK120002850
ECOCYC: G6239
ASAP: ABE-0001474
UniProt: P0A9J4 A0A387D133
Structure
PDB: 

Position
complement(443604..444515)
Genome map
AA seq 303 aa AA seqDB search
MKITVLGCGALGQLWLTALCKQGHEVQGWLRVPQPYCSVNLVETDGSIFNESLTANDPDF
LATSDLLLVTLKAWQVSDAVKSLASTLPVTTPILLIHNGMGTIEELQNIQQPLLMGTTTH
AARRDGNVIIHVANGITHIGPARQQDGDYSYLADILQTVLPDVAWHNNIRAELWRKLAVN
CVINPLTAIWNCPNGELRHHPQEIMQICEEVAAVIEREGHHTSAEDLRDYVMQVIDATAE
NISSMLQDIRALRHTEIDYINGFLLRRARAHGIAVPENTRLFEMVKRKESEYERIGTGLP
RPW
NT seq 912 nt NT seq  +upstreamnt  +downstreamnt
atgaaaattaccgtattgggatgcggtgccttagggcaattatggcttacagcactttgc
aaacagggtcatgaagttcagggctggctgcgcgtaccgcaaccttattgtagcgtgaat
ctggttgagacagatggttcgatatttaacgaatcgctgaccgccaacgatcccgatttt
ctcgccaccagcgatctgctcctggtgacgctgaaagcatggcaggtttccgatgccgtc
aaaagcctcgcgtccacactgcctgtaactacgccaatactgttaattcacaacggcatg
ggcaccatcgaagagttgcaaaacattcagcagccattactgatgggcaccaccacccat
gcagcccgccgcgacggcaatgtcattattcatgtggcaaacggtatcacgcatattggc
ccggcacggcaacaggacggggattacagttatctggcggatattttgcaaaccgtgttg
cctgacgttgcctggcataacaatattcgcgccgagctgtggcgcaagctggcagtcaac
tgcgtgattaatccactgactgccatctggaattgcccgaacggtgaattacgtcatcat
ccgcaagaaattatgcagatatgcgaagaagtcgcggcggtgatcgaacgcgaagggcat
catacttcagcagaagatttgcgtgattacgtgatgcaggtgattgatgccacagcggaa
aatatctcgtcgatgttgcaggatatccgcgcgctgcgccacactgaaatcgactatatc
aatggttttctcttacgccgcgcccgcgcgcatgggattgccgtaccggaaaacacccgc
ctgtttgaaatggtaaaaagaaaggagagtgaatatgagcgcatcggcactggtttgcct
cgcccctggtag

DBGET integrated database retrieval system