KEGG   Escherichia coli K-12 MG1655: b0440Help
Entry
b0440             CDS       T00007                                 

Gene name
hupB
Definition
(RefSeq) HU, DNA-binding transcriptional regulator, beta subunit
  KO
K03530  DNA-binding protein HU-beta
Organism
eco  Escherichia coli K-12 MG1655
Brite
KEGG Orthology (KO) [BR:eco00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:eco03032]
    b0440 (hupB)
   03036 Chromosome and associated proteins [BR:eco03036]
    b0440 (hupB)
   03400 DNA repair and recombination proteins [BR:eco03400]
    b0440 (hupB)
DNA replication proteins [BR:eco03032]
 Prokaryotic Type
  DNA Replication Initiation Factors
   Initiation factors (bacterial)
    b0440 (hupB)
Chromosome and associated proteins [BR:eco03036]
 Prokaryotic Type
  Nucleoid associated proteins
   HU (heat unstable protein)
    b0440 (hupB)
DNA repair and recombination proteins [BR:eco03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHIIR (short-homology-independent illegitimate recombination)
     Supressor
      b0440 (hupB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Bac_DNA_binding DUF4496 SeleniumBinding
Motif
Other DBs
NCBI-GeneID: 949095
NCBI-ProteinID: NP_414974
Pasteur: hupB
RegulonDB: ECK120000460
ECOCYC: EG10467
ASAP: ABE-0001527
UniProt: P0ACF4
Structure
PDB: 

Position
461451..461723
Genome map
AA seq 90 aa AA seqDB search
MNKSQLIDKIAAGADISKAAAGRALDAIIASVTESLKEGDDVALVGFGTFAVKERAARTG
RNPQTGKEITIAAAKVPSFRAGKALKDAVN
NT seq 273 nt NT seq  +upstreamnt  +downstreamnt
gtgaataaatctcaattgatcgacaagattgctgcaggggctgatatctctaaagctgcg
gctggccgtgcgttagatgctattattgcttccgtaactgaatctctgaaagaaggggat
gatgtagcactggtaggttttggtacttttgccgttaaagagcgtgctgcccgtactggc
cgcaacccgcagaccggtaaagagatcaccatcgctgctgctaaagtaccgagcttccgt
gcaggtaaagcactgaaagacgcggtaaactaa

DBGET integrated database retrieval system