KEGG   Escherichia coli K-12 MG1655: b0454Help
Entry
b0454             CDS       T00007                                 

Gene name
ybaZ
Definition
(RefSeq) excision repair protein, alkyltransferase-like protein ATL
  KO
K07443  methylated-DNA-protein-cysteine methyltransferase related protein
Organism
eco  Escherichia coli K-12 MG1655
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_binding_1
Motif
Other DBs
NCBI-GeneID: 945094
NCBI-ProteinID: NP_414988
Pasteur: ybaZ
RegulonDB: ECK120002861
ASAP: ABE-0001576
UniProt: P0AFP2
Position
complement(475982..476371)
Genome map
AA seq 129 aa AA seqDB search
MLVSCAMRLHSGVFPDYAEKLPQEEKMEKEDSFPQRVWQIVAAIPEGYVTTYGDVAKLAG
SPRAARQVGGVLKRLPEGSTLPWHRVVNRHGTISLTGPDLQRQRQALLAEGVMVSGSGQI
DLQRYRWNY
NT seq 390 nt NT seq  +upstreamnt  +downstreamnt
atgctggtttcttgcgcaatgcgacttcactcgggcgtttttccagattatgctgaaaaa
ttacctcaggaagaaaagatggaaaaagaagattcatttccccaacgcgtctggcaaatc
gtcgccgctattcccgaaggctatgtcaccacttacggtgatgtggcgaaactggcggga
tcgccccgcgccgcgcgccaggtgggcggtgtgttaaagcgtctccctgaaggcagcacc
ttaccctggcaccgggtggttaatcgccacggcacaatttcgctaaccggaccggattta
cagcgtcagcgacaggcattactggcagaaggtgtgatggtatcgggaagcgggcaaatc
gacttgcagcgttatcgctggaactactaa

DBGET integrated database retrieval system