KEGG   Escherichia coli K-12 MG1655: b0486
Entry
b0486             CDS       T00007                                 

Symbol
ybaT
Name
(RefSeq) putative transporter YbaT
Organism
eco  Escherichia coli K-12 MG1655
SSDB
Motif
Pfam: AA_permease_2 AA_permease
Other DBs
NCBI-GeneID: 945363
NCBI-ProteinID: NP_415019
Pasteur: ybaT
RegulonDB: ECK120002870
ECOCYC: G6262
ASAP: ABE-0001690
UniProt: P77400
Position
512576..513868
AA seq 430 aa
MMNTEGNNGNKPLGLWNVVSIGIGAMVGAGIFALLGQAALLMEASTWVAFAFGGIVAMFS
GYAYARLGASYPSNGGIIDFFRRGLGNGVFSLALSLLYLLTLAVSIAMVARAFGAYAVQF
LHEGSQEEHLILLYALGIIAVMTLFNSLSNHAVGRLEVILVGIKMMILLLLIIAGVWSLQ
PAHISVSAPPSSGAFFSCIGITFLAYAGFGMMANAADKVKDPQVIMPRAFLVAIGVTTLL
YISLALVLLSDVSALELEKYADTAVAQAASPLLGHVGYVIVVIGALLATASAINANLFAV
FNIMDNMGSERELPKLMNKSLWRQSTWGNIIVVVLIMLMTAALNLGSLASVASATFLICY
LAVFVVAIRLRHDIHASLPILIVGTLVMLLVIVGFIYSLWSQGSRALIWIIGSLLLSLIV
AMVMKRNKTV
NT seq 1293 nt   +upstreamnt  +downstreamnt
atgatgaacacggaaggtaataacggtaacaaacctctcggtctatggaacgtcgtttcc
atcggcattggggcaatggtgggggcggggatcttcgcgctgctggggcaggctgcattg
ctaatggaagcctcgacctgggtcgcctttgcttttggcggtattgtggcgatgttttcc
ggttatgcctatgcgcgtctgggggcgagctatcccagcaatggcggcattatcgacttc
tttcgtcgcggattaggcaacggcgtcttttcgctggcgctctcgttactgtacctgttg
acgctggcggtgagcatcgccatggtcgcccgtgcttttggcgcttatgccgtgcagttt
ttgcatgaaggcagccaggaggagcaccttattttgctctacgcgttggggatcattgcg
gtgatgacgcttttcaactccttaagcaaccatgcggtagggcggctggaagtgatcctc
gtcggcattaaaatgatgatcctgttattgctgattattgccggtgtctggtcgctgcaa
ccggcgcatatttccgtctctgcgccccccagctccggtgcgttcttctcctgtattggg
ataactttccttgcctatgcgggctttggcatgatggcgaacgcggcggataaagtgaaa
gatccgcaggtcattatgccacgggcgtttctggtggcgattggcgttaccacgttgctt
tatatctcgctggcactggttttgcttagcgatgtatcggcattagagttagaaaaatat
gccgataccgccgtagcgcaggctgcttctccgctgctcgggcatgtgggttatgtgatc
gtcgtcatcggcgctttactggcgacggcttcagccattaacgcgaacctgttcgccgtg
tttaacatcatggacaacatgggcagcgaacgcgaactgccgaagctaatgaataaatcc
ctgtggcggcagagtacctggggcaacattattgtcgtggtgttgattatgctgatgacg
gcggcactgaatttaggctcactcgccagcgttgccagcgccacctttttgatttgctac
ctggcggtgtttgtggtggcgatccgcctgcgtcatgatattcacgcctcgttgccgatt
cttatcgttggtacgttggtgatgttgttggtgatcgttggctttatctacagtctgtgg
tcccagggtagccgtgcgttgatatggattattggctcactcttactcagccttattgtg
gcaatggtcatgaagcgcaataaaaccgtataa

DBGET integrated database retrieval system