KEGG   Escherichia coli K-12 MG1655: b0511Help
Entry
b0511             CDS       T00007                                 

Gene name
ybbW
Definition
(RefSeq) putative allantoin transporter
  KO
K10975  allantoin permease
Organism
eco  Escherichia coli K-12 MG1655
Brite
KEGG Orthology (KO) [BR:eco00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:eco02000]
    b0511 (ybbW)
Transporters [BR:eco02000]
 Other Transporters
  Electrochemical potential-driven transporters [TC:2]
   b0511 (ybbW)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transp_cyt_pur
Motif
Other DBs
NCBI-GeneID: 945138
NCBI-ProteinID: NP_415044
Pasteur: ybbW
RegulonDB: ECK120002888
ECOCYC: G6280
ASAP: ABE-0001764
UniProt: P75712
Position
537633..539087
Genome map
AA seq 484 aa AA seqDB search
MEHQRKLFQQRGYSEDLLPKTQSQRTWKTFNYFTLWMGSVHNVPNYVMVGGFFILGLSTF
SIMLAIILSAFFIAAVMVLNGAAGSKYGVPFAMILRASYGVRGALFPGLLRGGIAAIMWF
GLQCYAGSLACLILIGKIWPGFLTLGGDFTLLGLSLPGLITFLIFWLVNVGIGFGGGKVL
NKFTAILNPCIYIVFGGMAIWAISLVGIGPIFDYIPSGIQKAENGGFLFLVVINAVVAVW
AAPAVSASDFTQNAHSFREQALGQTLGLVVAYILFAVAGVCIIAGASIHYGADTWNVLDI
VQRWDSLFASFFAVLVILMTTISTNATGNIIPAGYQIAAIAPTKLTYKNGVLIASIISLL
ICPWKLMENQDSIYLFLDIIGGMLGPVIGVMMAHYFVVMRGQINLDELYTAPGDYKYYDN
GFNLTAFSVTLVAVILSLGGKFIHFMEPLSRVSWFVGVIVAFAAYALLKKRTTAEKTGEQ
KTIG
NT seq 1455 nt NT seq  +upstreamnt  +downstreamnt
atggaacatcagagaaaactattccagcaacgcggctatagcgaagatctattgccgaaa
acgcaaagccagcggacctggaaaacatttaactattttaccttatggatgggttcggtt
cataacgttcccaattatgtgatggtcggcggcttttttattctcggcttgtctaccttt
agtattatgctggcaattatcctcagcgcctttttcattgccgcggtaatggtattaaac
ggtgctgcgggcagtaaatacggtgtgccttttgccatgatcctgcgtgcttcttacggt
gtacgtggtgcactgtttcccggattattaaggggcggaattgccgccatcatgtggttt
ggtttgcaatgttacgcggggtcactggcctgcttgattctgattggcaaaatctggccg
ggatttttaactctcggtggtgatttcactctgttaggcctttctctaccgggcttaatt
actttcttaatcttctggctggtcaacgttggtataggttttggcggtggcaaagtttta
aataaattcactgccattcttaacccgtgcatctatatcgttttcggcggtatggcgatt
tgggcgatttcactggtcgggatcggtccaatctttgactacattccgagcggtattcag
aaagcagaaaacggtggcttcctgttcctggtggtgattaacgcggtagttgcggtctgg
gcggcaccggcggtgagcgcatccgactttacgcaaaacgcccactcgtttcgtgagcag
gcgctggggcaaacgctgggtttagttgtggcctatattctgtttgcggtcgccggggta
tgtattattgccggagccagtattcactacggcgctgatacctggaacgtgctggatatt
gttcagcgttgggacagcctgttcgcctcgttctttgcggtactggttattctgatgaca
actatctccactaacgcgaccggtaatattattccagccggttatcagattgccgccatt
gcaccgacaaaactgacctataaaaacggcgtactgattgccagtattatcagcttgctg
atctgcccgtggaaattaatggaaaatcaggacagcatttatcttttcctcgatattatc
ggcggaatgcttggtccggtaattggtgtcatgatggcgcattattttgtggtgatgcgc
ggacaaattaatcttgatgaactgtataccgcacctggcgattataaatattacgataac
ggttttaacctcactgcgttttcagtaactctggtggccgttattttatctcttggcggt
aagtttattcactttatggaaccgttatcgcgtgtttcatggtttgtcggcgtcatcgtc
gcctttgcggcctacgccttattaaagaaacgtacaacagcagaaaaaacaggagagcaa
aaaaccataggttaa

DBGET integrated database retrieval system