KEGG   Escherichia coli K-12 MG1655: b0532Help
Entry
b0532             CDS       T00007                                 

Gene name
sfmD
Definition
(RefSeq) putative fimbrial usher protein SfmD
  KO
K07354  outer membrane usher protein
Organism
eco  Escherichia coli K-12 MG1655
Brite
KEGG Orthology (KO) [BR:eco00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02035 Bacterial motility proteins [BR:eco02035]
    b0532 (sfmD)
Bacterial motility proteins [BR:eco02035]
 Pilus system
  Fimbrial proteins
   b0532 (sfmD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Usher PapC_N PapC_C DUF4888 OEP
Motif
Other DBs
NCBI-GeneID: 945160
NCBI-ProteinID: NP_415065
Pasteur: sfmD
RegulonDB: ECK120002900
ECOCYC: G6292
ASAP: ABE-0001830
UniProt: P77468 A0A387D6P6
Position
559697..562300
Genome map
AA seq 867 aa AA seqDB search
MKIPTTTDIPQRYTWCLAGICYSSLAILPSFLSYAESYFNPAFLLENGTSVADLSRFERG
NHQPAGVYRVDLWRNDEFIGSQDIVFESTTENTGDKSGGLMPCFNQVLLERIGLNSSAFP
ELAQQQNNKCINLLKAVPDATINFDFAAMRLNITIPQIALLSSAHGYIPPEEWDEGIPAL
LLNYNFTGNRGNGNDSYFFSELSGINIGPWRLRNNGSWNYFRGNGYHSEQWNNIGTWVQR
AIIPLKSELVMGDGNTGSDIFDGVGFRGVRLYSSDNMYPDSQQGFAPTVRGIARTAAQLT
IRQNGFIIYQSYVSPGAFEITDLHPTSSNGDLDVTIDERDGNQQNYTIPYSTVPILQREG
RFKFDLTAGDFRSGNSQQSSPFFFQGTALGGLPQEFTAYGGTQLSANYTAFLLGLGRNLG
NWGAVSLDVTHARSQLADASRHEGDSIRFLYAKSMNTFGTNFQLMGYRYSTQGFYTLDDV
AYRRMEGYEYDYDGEHRDEPIIVNYHNLRFSRKDRLQLNVSQSLNDFGSLYISGTHQKYW
NTSDSDTWYQVGYTSSWVGISYSLSFSWNESVGIPDNERIVGLNVSVPFNVLTKRRYTRE
NALDRAYASFNANRNSNGQNSWLAGVGGTLLEGHNLSYHVSQGDTSNNGYTGSATANWQA
AYGTLGGGYNYDRDQHDVNWQLSGGVVGHENGITLSQPLGDTNVLIKAPGAGGVRIENQT
GILTDWRGYAVMLYATVYRYNRIALDTNTMGNSIDVEKNISSVVPTQGALVRANFDTRIG
VRALITVTQGGKPVPFGSLVRENSTGITSMVGDDGQVYLSGAPLSGELLVQWGDGANSRC
IAHYVLPKQSLQQAVTVISAVCTHPGS
NT seq 2604 nt NT seq  +upstreamnt  +downstreamnt
atgaaaatacccactactacggatattccgcagaggtatacctggtgtctggccggaatt
tgttattcatctcttgccattttaccctcctttttaagctatgcggaaagttatttcaac
ccggcatttttattagagaatggcacatccgttgctgatttatcgcgctttgagagaggt
aatcatcaacctgcgggcgtgtatcgggtggatctctggcgtaatgatgagttcattggt
tcgcaggatatcgtatttgaatcgacaacagaaaatacaggtgataaatcaggtgggtta
atgccctgttttaaccaggtacttcttgaacgaattggccttaatagcagtgcatttccc
gagttagcccagcagcaaaacaataaatgcatcaatttactgaaagctgtacctgatgcc
acaattaactttgattttgcagcgatgcgcctgaacatcactattcctcagatagcgttg
ttgagtagcgctcacggttacattccgcctgaagagtgggatgaaggtattcctgcttta
ctcctgaattataatttcaccggtaacagaggtaatggtaacgatagctatttttttagt
gagctcagcgggattaatattggcccgtggcgtttacgcaacaatggttcctggaactat
tttcgcggaaatggatatcattcagaacagtggaataatattggcacctgggtacagcgc
gccattattccgctgaaaagtgaactggtaatgggagacggcaatacaggaagtgatatt
ttcgatggcgttggatttcgtggtgtacggctttattcttctgataatatgtatcctgat
agccagcaagggtttgccccaacggtacgtgggattgcccgtacggcggcccagctaacg
attcggcaaaatggttttattatctatcaaagctatgtttcccccggcgcttttgaaatt
acagatttgcacccgacatcttcaaatggcgatctggacgtcaccatcgacgagcgcgat
ggcaatcagcagaattacacaattccgtattcaacagtgccaattttacaacgcgaaggg
cgtttcaaatttgacctgacggcgggcgattttcgtagcggtaatagtcagcaatcatcg
cctttcttttttcagggtacggcactcggcggtttaccacaggaatttactgcctacggc
gggacgcaattatctgccaattacaccgcctttttattagggctggggcgcaatctcggg
aactggggcgcagtgtcgctggatgtaacgcatgcgcgcagtcagttagccgacgccagt
cgtcatgagggggattctattcgcttcctctatgcgaaatcgatgaacaccttcggcacc
aattttcagttaatgggttaccgctattcgacacaaggtttttatacccttgatgatgtt
gcgtatcgtcgaatggaggggtacgaatatgattacgacggtgagcatcgcgatgaaccg
ataatcgtgaattaccacaatttacgctttagccgtaaagaccgtttgcagttaaatgtt
tcacaatcacttaatgactttggctcgctttatatttctggtacccatcaaaaatactgg
aatacttcggattcagatacgtggtatcaggtggggtataccagcagctgggttggcatc
agttattcgctctcattttcgtggaatgaatctgtagggatccccgataacgaacgtatt
gtcggacttaatgtttcagtgcctttcaatgttttgaccaaacgtcgctacacccgggaa
aatgcgctcgaccgcgcttatgcctcctttaacgccaaccgtaacagcaacgggcaaaat
agctggctggcaggtgtaggtgggaccttactggaaggccacaacctgagttatcacgta
agccagggtgatacctcgaataatgggtacacgggcagcgccacggcaaactggcaggcc
gcttacggtacgctggggggcgggtataactacgaccgcgatcaacatgacgttaactgg
cagctgtctggcggtgtggtcgggcatgaaaatggcataacgctgagccagcctttaggg
gataccaatgttttgattaaagcgcctggcgcaggcggtgtacgcattgaaaatcaaact
ggcattttaaccgactggcgcggctatgcggtgatgctgtatgccacggtttatcggtat
aaccgtatcgcgcttgataccaatacgatggggaattccatcgatgttgaaaaaaatatt
agcagcgttgtgccgacgcaaggcgcgttggttcgtgccaattttgatacccgcataggc
gtgcgggcgctcattaccgttacccagggcggaaaaccggtgccgtttggatcactggta
cgggaaaacagtaccggaataaccagtatggtgggtgatgacgggcaagtttatttaagt
ggtgcgccattgtctggtgaattactggttcagtggggagacggcgcgaactcacgctgc
attgcgcactatgtattgccgaagcaaagcttacagcaagccgtcactgttatttcggca
gtttgcacacatcctggctcataa

DBGET integrated database retrieval system