KEGG   Escherichia coli K-12 MG1655: b0543Help
Entry
b0543             CDS       T00007                                 

Gene name
emrE
Definition
(RefSeq) DLP12 prophage; multidrug resistance protein
  KO
K03297  small multidrug resistance pump
Organism
eco  Escherichia coli K-12 MG1655
Brite
KEGG Orthology (KO) [BR:eco00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:eco02000]
    b0543 (emrE)
Transporters [BR:eco02000]
 Other Transporters
  Electrochemical potential-driven transporters [TC:2]
   b0543 (emrE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Multi_Drug_Res EamA EmrE UPF0060
Motif
Other DBs
NCBI-GeneID: 948442
NCBI-ProteinID: NP_415075
Pasteur: emrE
RegulonDB: ECK120000622
ECOCYC: EG10629
ASAP: ABE-0001863
UniProt: P23895
Structure
PDB: 

Position
568315..568647
Genome map
AA seq 110 aa AA seqDB search
MNPYIYLGGAILAEVIGTTLMKFSEGFTRLWPSVGTIICYCASFWLLAQTLAYIPTGIAY
AIWSGVGIVLISLLSWGFFGQRLDLPAIIGMMLICAGVLIINLLSRSTPH
NT seq 333 nt NT seq  +upstreamnt  +downstreamnt
atgaacccttatatttatcttggtggtgcaatacttgcagaggtcattggtacaacctta
atgaagttttcagaaggttttacacggttatggccatctgttggtacaattatttgttat
tgtgcatcattctggttattagctcagacgctggcttatattcctacagggattgcttat
gctatctggtcaggagtcggtattgtcctgattagcttactgtcatggggatttttcggc
caacggctggacctgccagccattataggcatgatgttgatttgtgccggtgtgttgatt
attaatttattgtcacgaagcacaccacattaa

DBGET integrated database retrieval system