KEGG   Escherichia coli K-12 MG1655: b0545Help
Entry
b0545             CDS       T00007                                 

Gene name
ybcL
Definition
(RefSeq) DLP12 prophage; periplasmic protein YbcL
  KO
K06910  uncharacterized protein
Organism
eco  Escherichia coli K-12 MG1655
Brite
KEGG Orthology (KO) [BR:eco00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99997 Function unknown
    b0545 (ybcL)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PBP Defensin_propep
Motif
Other DBs
NCBI-GeneID: 945165
NCBI-ProteinID: NP_415077
Pasteur: ybcL
RegulonDB: ECK120002909
ECOCYC: G6301
ASAP: ABE-0001869
UniProt: P77368
Structure
PDB: 

Position
570893..571444
Genome map
AA seq 183 aa AA seqDB search
MKTLIVSTVLAFITFSAQAAAFQVTSNEIKTGEQLTTSHVFSGFGCEGGNTSPSLTWSGV
PEGTKSFAVTVYDPDAPTGSGWWHWTVVNIPATVTYLPVDAGRRDGTKLPTGAVQGRNDF
GYAGFGGACPPKGDKPHHYQFKVWALKTEKIPVDSNSSGALVGYMLNANKIATAEITPVY
EIK
NT seq 552 nt NT seq  +upstreamnt  +downstreamnt
atgaaaacacttatcgtttcaactgtattggcattcataacattttctgcgcaggctgca
gcatttcaggtcactagtaatgaaataaaaacaggagagcaacttacaacgtctcatgtc
ttttctggatttgggtgtgaaggtggtaatacatcgccctcattaacctggtctggtgtt
cctgaaggtaccaaaagctttgccgtaactgtatatgatccagatgcacctacaggcagt
ggttggtggcattggactgttgttaatattccagcaacagtaacatatttgcccgttgat
gcagggagacgtgatggaacaaaactgccgactggtgctgttcaaggccgaaatgatttt
ggctatgctgggtttggtggcgcatgtcctcctaaaggagataaaccacatcattaccag
tttaaagtatgggctctaaaaactgaaaagattcctgtagattctaactccagcggagcg
ttagttggttatatgcttaatgctaataaaatcgcaaccgctgagataacaccagtttat
gagataaagtag

DBGET integrated database retrieval system