KEGG   Escherichia coli K-12 MG1655: b0594
Entry
b0594             CDS       T00007                                 

Gene name
entE
Definition
(RefSeq) 2,3-dihydroxybenzoate-AMP ligase
  KO
K02363  2,3-dihydroxybenzoate-AMP ligase [EC:6.3.2.14 2.7.7.58]
Organism
eco  Escherichia coli K-12 MG1655
Pathway
eco01053  Biosynthesis of siderophore group nonribosomal peptides
eco01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:eco00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   01053 Biosynthesis of siderophore group nonribosomal peptides
    b0594 (entE)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01008 Polyketide biosynthesis proteins [BR:eco01008]
    b0594 (entE)
Enzymes [BR:eco01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.58  (2,3-dihydroxybenzoyl)adenylate synthase
     b0594 (entE)
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.14  enterobactin synthase
     b0594 (entE)
Polyketide biosynthesis proteins [BR:eco01008]
 Nonribosomal peptide synthetase (NRPS)
  Iterative NRPS
   Enterobactin synthetase
    b0594 (entE)
   Bacillibactin synthetase
    b0594 (entE)
  Nonlinear NRPS
   Vibriobactin synthetase
    b0594 (entE)
   Myxochelin synthetase
    b0594 (entE)
SSDB
Motif
Pfam: AMP-binding AMP-binding_C GH3 Autoind_bind
Other DBs
NCBI-GeneID: 947426
NCBI-ProteinID: NP_415126
Pasteur: entE
RegulonDB: ECK120000257
ECOCYC: EG10263
ASAP: ABE-0002049
UniProt: P10378
Structure
PDB: 
4IZ6 6IYK 6IYL 3RG2

Position
626070..627680
AA seq 536 aa
MSIPFTRWPEEFARRYREKGYWQDLPLTDILTRHAASDSIAVIDGERQLSYRELNQAADN
LACSLRRQGIKPGETALVQLGNVAELYITFFALLKLGVAPVLALFSHQRSELNAYASQIE
PALLIADRQHALFSGDDFLNTFVTEHSSIRVVQLLNDSGEHNLQDAINHPAEDFTATPSP
ADEVAYFQLSGGTTGTPKLIPRTHNDYYYSVRRSVEICQFTQQTRYLCAIPAAHNYAMSS
PGSLGVFLAGGTVVLAADPSATLCFPLIEKHQVNVTALVPPAVSLWLQALIEGESRAQLA
SLKLLQVGGARLSATLAARIPAEIGCQLQQVFGMAEGLVNYTRLDDSAEKIIHTQGYPMC
PDDEVWVADAEGNPLPQGEVGRLMTRGPYTFRGYYKSPQHNASAFDANGFYCSGDLISID
PEGYITVQGREKDQINRGGEKIAAEEIENLLLRHPAVIYAALVSMEDELMGEKSCAYLVV
KEPLRAVQVRRFLREQGIAEFKLPDRVECVDSLPLTAVGKVDKKQLRQWLASRASA
NT seq 1611 nt   +upstreamnt  +downstreamnt
atgagcattccattcacccgctggccggaagagtttgcccgtcgctatcgggaaaaaggc
tactggcaggatttgccgctgaccgacattctgacgcgacatgctgcgagtgacagcatc
gcggttatcgacggcgagcgacagttgagttatcgggagctgaatcaggcggcggataac
ctcgcgtgtagtttacgccgtcagggcattaaacctggtgaaaccgcgctggtacaactg
ggtaacgtcgctgaattgtatattacctttttcgcgctgctgaaactgggcgttgcgccg
gtgctggcgttgttcagccatcagcgtagtgaactgaacgcctatgccagccagattgaa
cccgcattgctgattgccgatcgccaacatgcgctgtttagcggggatgatttcctcaat
actttcgtcacagaacattcctccattcgcgtggtgcaactgctcaacgacagcggtgag
cataacttgcaggatgcgattaaccatccggctgaggattttactgccacgccatcacct
gctgatgaagtggcctatttccagctttccggtggcaccaccggcacaccgaaactgatc
ccgcgcactcataacgactactactacagcgtgcgtcgtagcgtcgagatttgtcagttc
acacaacagacacgctacctgtgcgcgatcccggcggctcataactacgccatgagttcg
ccaggatcgctgggcgtctttcttgccggaggaacggttgttctggcggccgatcccagc
gccacgctctgtttcccattgattgaaaaacatcaggttaacgttaccgcgctggtgcca
cccgcagtcagcctgtggttgcaggcgctgatcgaaggcgaaagccgggcgcagcttgcc
tcgctgaaactgttacaggtcggcggcgcacgtctttctgccacccttgcggcgcgtatt
cccgctgagattggctgtcagttgcagcaggtgtttggcatggcggaagggctggtgaac
tacacccgacttgatgatagcgcggagaaaattatccatacccagggttacccaatgtgt
ccggatgacgaagtatgggttgccgatgccgaaggaaatccactgccgcaaggggaagtc
ggacgcctgatgacgcgcgggccgtacaccttccgcggctattacaaaagtccacagcac
aatgccagcgcctttgatgccaacggtttttactgttccggcgatctgatctctattgat
ccagagggttacatcaccgtgcaggggcgcgagaaagatcagattaaccgtggcggcgag
aagatcgctgccgaagagatcgaaaacctgctgctgcgccacccggcggtgatctacgcc
gcactggtgagcatggaagatgagctgatgggcgaaaaaagctgcgcttatctggtggta
aaagagccgctgcgcgcggtgcaggtgcgtcgtttcctgcgtgaacagggtattgccgaa
tttaaattaccggatcgcgtggagtgtgtggattcacttccgctgacggcggtcgggaaa
gtcgataaaaaacaattacgtcagtggctggcgtcacgcgcatcagcctga

DBGET integrated database retrieval system