KEGG   Escherichia coli K-12 MG1655: b0595
Entry
b0595             CDS       T00007                                 

Gene name
entB
Definition
(RefSeq) enterobactin synthase component B
  KO
K01252  bifunctional isochorismate lyase / aryl carrier protein [EC:3.3.2.1 6.3.2.14]
Organism
eco  Escherichia coli K-12 MG1655
Pathway
eco01053  Biosynthesis of siderophore group nonribosomal peptides
eco01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:eco00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   01053 Biosynthesis of siderophore group nonribosomal peptides
    b0595 (entB)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01008 Polyketide biosynthesis proteins [BR:eco01008]
    b0595 (entB)
Enzymes [BR:eco01000]
 3. Hydrolases
  3.3  Acting on ether bonds
   3.3.2  Ether hydrolases
    3.3.2.1  isochorismatase
     b0595 (entB)
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.14  enterobactin synthase
     b0595 (entB)
Polyketide biosynthesis proteins [BR:eco01008]
 Nonribosomal peptide synthetase (NRPS)
  Iterative NRPS
   Enterobactin synthetase
    b0595 (entB)
   Bacillibactin synthetase
    b0595 (entB)
  Nonlinear NRPS
   Vibriobactin synthetase
    b0595 (entB)
   Myxochelin synthetase
    b0595 (entB)
SSDB
Motif
Pfam: Isochorismatase PP-binding
Other DBs
NCBI-GeneID: 946178
NCBI-ProteinID: NP_415127
Pasteur: entB
RegulonDB: ECK120000254
ECOCYC: EG10260
ASAP: ABE-0002052
UniProt: P0ADI4
Structure
PDB: 
2FQ1

Position
627694..628551
AA seq 285 aa
MAIPKLQAYALPESHDIPQNKVDWAFEPQRAALLIHDMQDYFVSFWGENCPMMEQVIANI
AALRDYCKQHNIPVYYTAQPKEQSDEDRALLNDMWGPGLTRSPEQQKVVDRLTPDADDTV
LVKWRYSAFHRSPLEQMLKESGRNQLIITGVYAHIGCMTTATDAFMRDIKPFMVADALAD
FSRDEHLMSLKYVAGRSGRVVMTEELLPAPIPASKAALREVILPLLDESDEPFDDDNLID
YGLDSVRMMALAARWRKVHGDIDFVMLAKNPTIDAWWKLLSREVK
NT seq 858 nt   +upstreamnt  +downstreamnt
atggctattccaaaattacaggcttacgcactgccggagtctcacgatattccgcagaat
aaagttgactgggcctttgaaccgcaacgtgccgcgttgttaatccatgatatgcaggac
tattttgtcagcttctggggcgagaactgcccgatgatggagcaggtgatcgcgaatatt
gctgcgctgcgcgactactgcaaacagcacaatatcccggtttattacaccgcccagccg
aaagagcagagcgatgaagatcgggcgctgttgaatgatatgtgggggccgggcctgacc
cgctcgccggaacagcaaaaggtggtggatcgcctgacgccagatgccgacgacacggtg
ctggtgaagtggcgctacagcgcgtttcatcgttctccgctggagcaaatgctgaaagag
agtggacgtaaccagctgattattaccggggtatatgcccacattggctgtatgaccacc
gcaaccgacgcatttatgcgcgatattaaaccgtttatggtggcggatgcgctggccgat
ttcagccgtgacgagcatttgatgtcgctgaaatatgtggccggacgttctggccgggtg
gtgatgactgaagaattactgccagcacctatccccgccagcaaagcggcgctgcgtgag
gtgatcctgccgttgctggacgagtccgatgaaccgttcgatgacgacaacctgatcgac
tacggtctggattcggtgcgcatgatggcgctggcggcgcgctggcgcaaagtgcatggt
gatatcgactttgtcatgctggcgaaaaacccgaccatcgacgcctggtggaagctactc
tcccgcgaggtgaaataa

DBGET integrated database retrieval system