KEGG   Escherichia coli K-12 MG1655: b0630Help
Entry
b0630             CDS       T00007                                 

Gene name
lipB
Definition
(RefSeq) octanoyltransferase; octanoyl-[ACP]:protein N-octanoyltransferase
  KO
K03801  lipoyl(octanoyl) transferase [EC:2.3.1.181]
Organism
eco  Escherichia coli K-12 MG1655
Pathway
eco00785  Lipoic acid metabolism
eco01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:eco00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00785 Lipoic acid metabolism
    b0630 (lipB)
Enzymes [BR:eco01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.181  lipoyl(octanoyl) transferase
     b0630 (lipB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: BPL_LplA_LipB
Motif
Other DBs
NCBI-GeneID: 945217
NCBI-ProteinID: NP_415163
Pasteur: lipB
RegulonDB: ECK120001540
ECOCYC: EG11591
ASAP: ABE-0002160
UniProt: P60720
Position
complement(661637..662278)
Genome map
AA seq 213 aa AA seqDB search
MYQDKILVRQLGLQPYEPISQAMHEFTDTRDDSTLDEIWLVEHYPVFTQGQAGKAEHILM
PGDIPVIQSDRGGQVTYHGPGQQVMYVLLNLKRRKLGVRELVTLLEQTVVNTLAELGIEA
HPRADAPGVYVGEKKICSLGLRIRRGCSFHGLALNVNMDLSPFLRINPCGYAGMEMAKIS
QWKPEATTNNIAPRLLENILALLNNPDFEYITA
NT seq 642 nt NT seq  +upstreamnt  +downstreamnt
ttgtatcaggataaaattcttgtccgccagctcggtcttcagccttacgagccaatctcc
caggctatgcatgaattcaccgatacccgcgatgatagtacccttgatgaaatctggctg
gtcgagcactatccggtattcacccaaggtcaggcaggaaaagcggagcacattttaatg
ccgggtgatattccggtgatccagagcgatcgcggtgggcaggtgacttatcacgggccg
gggcaacaggtgatgtatgtgttgcttaacctgaaacgccgtaaactcggtgtgcgtgaa
ctggtgaccttgcttgagcaaacagtggtgaataccctggctgaactgggtatagaagcg
catcctcgggctgacgcgccaggtgtctatgttggggaaaagaaaatttgctcactgggt
ttacgtattcgacgcggttgttcattccacggtctggcattaaacgtcaatatggatctt
tcaccatttttacgtattaatccttgtgggtatgccggaatggaaatggctaaaatatca
caatggaaacccgaagcgacgactaataatattgctccacgtttactggaaaatatttta
gcgctactaaacaatccggacttcgaatatattaccgcttaa

DBGET integrated database retrieval system