KEGG   Escherichia coli K-12 MG1655: b0633Help
Entry
b0633             CDS       T00007                                 

Gene name
rlpA
Definition
(RefSeq) rare lipoprotein RlpA
  KO
K03642  rare lipoprotein A
Organism
eco  Escherichia coli K-12 MG1655
Brite
KEGG Orthology (KO) [BR:eco00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99992 Structural proteins
    b0633 (rlpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DPBB_1 SPOR
Motif
Other DBs
NCBI-GeneID: 945241
NCBI-ProteinID: NP_415166
Pasteur: rlpA
RegulonDB: ECK120000845
ECOCYC: EG10854
ASAP: ABE-0002171
UniProt: P10100
Position
complement(664102..665190)
Genome map
AA seq 362 aa AA seqDB search
MRKQWLGICIAAGMLAACTSDDGQQQTVSVPQPAVCNGPIVEISGADPRFEPLNATANQD
YQRDGKSYKIVQDPSRFSQAGLAAIYDAEPGSNLTASGEAFDPTQLTAAHPTLPIPSYAR
ITNLANGRMIVVRINDRGPYGNDRVISLSRAAADRLNTSNNTKVRIDPIIVAQDGSLSGP
GMACTTVAKQTYALPAPPDLSGGAGTSSVSGPQGDILPVSNSTLKSEDPTGAPVTSSGFL
GAPTTLAPGVLEGSEPTPAPQPVVTAPSTTPATSPAMVTPQAVSQSASGNFMVQVGAVSD
QARAQQYQQQLGQKFGVPGRVTQNGAVWRIQLGPFASKAEASTLQQRLQTEAQLQSFITT
AQ
NT seq 1089 nt NT seq  +upstreamnt  +downstreamnt
atgcgtaagcagtggctcgggatctgcatcgcggcaggaatgctcgcggcatgtacaagc
gatgatggtcagcaacagacggtaagtgtaccgcagcctgcggtatgtaacggccctata
gttgaaattagcggggcggacccgcgtttcgaaccactgaacgcgacggcaaatcaggat
taccagcgcgacggtaaaagctacaaaatcgtgcaggatccgtctcgatttagccaggcg
ggactggcggcaatctatgatgccgaacccggcagtaacctgacggcctctggcgaagca
ttcgatccgacacagctgacggcagcccatccaacgcttccgatccccagctacgccaga
atcactaacctggctaacgggcgaatgatcgtggtgcgcattaatgatcgcggcccttac
ggcaacgaccgcgttatttcactttctcgcgcggcagctgaccgtcttaacacgtcaaac
aacaccaaagttcgtatcgatccgattattgttgcccaggatggttcgctttctggtcct
ggtatggcttgtaccacagtcgccaaacagacttacgccctgcctgcacctcccgattta
agcggtggcgcgggaacaagttcagtgtctggcccgcagggtgacattcttccggtcagt
aattcgacgctaaaaagcgaagatccgaccggcgcgccggtaaccagtagcggtttcctc
ggcgcaccaacgaccttagcgcctggtgtactggaaggcagcgaaccgacgcctgcgcca
cagcccgttgttacagctccgtcgacaacgcctgcaacctcgcctgcaatggtgacaccg
caagccgtctcgcaaagcgccagcggcaactttatggtgcaagtcggggccgtaagcgat
caggctcgtgcgcaacagtaccaacagcaactgggacagaagttcggcgtccccggtcgc
gtaactcaaaatggcgcggtctggcggatccagcttggcccattcgccagcaaagccgaa
gccagtaccttgcagcaacgtttgcaaaccgaagcccaattacagtcatttattactacc
gcgcagtag

DBGET integrated database retrieval system