KEGG   Escherichia coli K-12 MG1655: b0643
Entry
b0643             CDS       T00007                                 

Gene name
ybeL
Definition
(RefSeq) DUF1451 domain-containing protein YbeL
Organism
eco  Escherichia coli K-12 MG1655
SSDB
Motif
Pfam: DUF1451 TniQ Apolipoprotein VbhA DUF4709 Herpes_UL92 Zn-ribbon_8
Other DBs
NCBI-GeneID: 945252
NCBI-ProteinID: NP_415176
Pasteur: ybeL
RegulonDB: ECK120002400
ECOCYC: EG12851
ASAP: ABE-0002199
UniProt: P0AAT9
Position
675018..675500
AA seq 160 aa
MNKVAQYYRELVASLSERLRNGERDIDALVEQARERVIKTGELTRTEVDELTRAVRRDLE
EFAMSYEESLKEESDSVFMRVIKESLWQELADITDKTQLEWREVFQDLNHHGVYHSGEVV
GLGNLVCEKCHFHLPIYTPEVLTLCPKCGHDQFQRRPFEP
NT seq 483 nt   +upstreamnt  +downstreamnt
atgaacaaggttgctcaatattaccgtgaactggttgcgtcactgagcgaacgcctgcgc
aatggcgaacgtgatatcgacgcactggtggaacaggcgcgcgagcgcgtaataaaaaca
ggggagttaacgcgaaccgaggtcgatgagctgacgcgagctgtcagacgtgacctggaa
gagttcgccatgagctatgaagagagcctgaaagaagaatctgacagcgtctttatgcgg
gtgattaaagaaagcttgtggcaggagctggcagacatcaccgataaaacgcagcttgaa
tggcgcgaagttttccaggacctcaatcatcatggggtttatcacagcggagaagtggtc
gggctgggaaatctggtctgcgagaaatgtcacttccatctcccgatctacacaccggaa
gtgctgacgctatgcccgaaatgtggtcatgaccagttccagagacgcccgtttgagccg
taa

DBGET integrated database retrieval system