KEGG   Escherichia coli K-12 MG1655: b0651Help
Entry
b0651             CDS       T00007                                 

Gene name
rihA
Definition
(RefSeq) pyrimidine-specific ribonucleoside hydrolase RihA
  KO
K01250  pyrimidine-specific ribonucleoside hydrolase [EC:3.2.-.-]
Organism
eco  Escherichia coli K-12 MG1655
Brite
KEGG Orthology (KO) [BR:eco00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    b0651 (rihA)
Enzymes [BR:eco01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.-  Glycosylases
    3.2.-.-  
     b0651 (rihA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IU_nuc_hydro
Motif
Other DBs
NCBI-GeneID: 945503
NCBI-ProteinID: NP_415184
Pasteur: ybeK
RegulonDB: ECK120002965
ECOCYC: G6358
ASAP: ABE-0002227
UniProt: P41409
Structure
PDB: 

Position
complement(683477..684412)
Genome map
AA seq 311 aa AA seqDB search
MALPILLDCDPGHDDAIAIVLALASPELDVKAITSSAGNQTPEKTLRNVLRMLTLLNRTD
IPVAGGAVKPLMRELIIADNVHGESGLDGPALPEPTFAPQNCTAVELMAKTLRESAEPVT
IVSTGPQTNVALLLNSHPELHSKIARIVIMGGAMGLGNWTPAAEFNIYVDPEAAEIVFQS
GIPVVMAGLDVTHKAQIHVEDTERFRAIGNPVSTIVAELLDFFLEYHKDEKWGFVGAPLH
DPCTIAWLLKPELFTSVERWVGVETQGKYTQGMTVVDYYYLTGNKPNATVMVDVDRQGFV
DLLADRLKFYA
NT seq 936 nt NT seq  +upstreamnt  +downstreamnt
atggcactgccaattctgttagattgcgacccaggtcatgacgacgctatcgcaatagtt
ctcgccctcgcctcaccagagcttgatgtcaaagcaattacgtcttccgccggaaaccag
acaccagaaaaaaccttacgcaatgttctgcgtatgctgaccttgcttaatcgcaccgat
attccggtagcaggcggcgcggtaaaaccgttaatgcgtgagttgattatcgcggacaat
gtgcacggcgaaagcggtctcgacggcccggcattaccggaaccgacattcgcaccgcaa
aactgtacggcggtagagctgatggcgaaaacgctgcgtgaaagtgcggaacctgtcacc
attgtgtctaccggaccgcaaactaacgttgccttgctgctcaatagccatccggaactg
catagcaaaattgcccgtatcgtgattatgggtggcgctatggggctgggtaactggacg
cctgcggctgaatttaatatttacgttgacccggaagcggcagaaattgtcttccagtca
gggatcccggtggtgatggccggtctggatgttactcataaagcacaaatccacgttgaa
gacaccgagcgtttccgcgcgattggtaaccctgtttcaaccattgttgccgaactgctg
gatttcttcctcgaatatcataaagacgaaaaatggggctttgtcggcgcaccactgcat
gacccatgcaccatcgcctggctgttgaaaccggagttatttacctctgttgagcgctgg
gttggcgtggaaacacaggggaaatatacccagggtatgacggttgttgattattattat
ctgacaggcaataaaccgaatgccaccgtaatggtcgatgttgatcgtcagggctttgtt
gatttactggctgatcgtctgaaattttacgcttaa

DBGET integrated database retrieval system