KEGG   Escherichia coli K-12 MG1655: b0655Help
Entry
b0655             CDS       T00007                                 

Gene name
gltI
Definition
(RefSeq) glutamate/aspartate periplasmic binding protein
  KO
K10001  glutamate/aspartate transport system substrate-binding protein
Organism
eco  Escherichia coli K-12 MG1655
Pathway
eco02010  ABC transporters
eco02020  Two-component system
Module
eco_M00230  Glutamate/aspartate transport system
Brite
KEGG Orthology (KO) [BR:eco00001]
 Environmental Information Processing
  Membrane transport
   02010 ABC transporters
    b0655 (gltI)
  Signal transduction
   02020 Two-component system
    b0655 (gltI)
Transporters [BR:eco02000]
 ABC Transporters, Prokaryotic Type
  Phosphate and amino acid transporters
   Glutamate/aspartate transporter [MD:M00230] [OT]
    b0655 (gltI)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SBP_bac_3 NMT1 DUF3991
Motif
Other DBs
NCBI-GeneID: 946938
NCBI-ProteinID: NP_415188
Pasteur: ybeJ
RegulonDB: ECK120002966
ECOCYC: G6359
ASAP: ABE-0002241
UniProt: P37902
Position
complement(686839..687747)
Genome map
AA seq 302 aa AA seqDB search
MQLRKPATAILALALSAGLAQADDAAPAAGSTLDKIAKNGVIVVGHRESSVPFSYYDNQQ
KVVGYSQDYSNAIVEAVKKKLNKPDLQVKLIPITSQNRIPLLQNGTFDFECGSTTNNVER
QKQAAFSDTIFVVGTRLLTKKGGDIKDFANLKDKAVVVTSGTTSEVLLNKLNEEQKMNMR
IISAKDHGDSFRTLESGRAVAFMMDDALLAGERAKAKKPDNWEIVGKPQSQEAYGCMLRK
DDPQFKKLMDDTIAQVQTSGEAEKWFDKWFKNPIPPKNLNMNFELSDEMKALFKEPNDKA
LN
NT seq 909 nt NT seq  +upstreamnt  +downstreamnt
atgcaattacgtaaacctgccacagcaatcctcgccctggcgctttccgcaggactggca
caggcagatgacgccgccccggcagcgggcagtactctggacaaaatcgccaaaaacggt
gtgattgtcgtcggtcaccgtgaatcttcagtgcctttctcttattacgacaatcagcaa
aaagtggtgggttactcgcaggattactccaacgccattgttgaagcagtgaaaaagaaa
ctcaacaaaccggacttgcaggtaaaactgattccgattacctcacaaaaccgtattcca
ctgctgcaaaacggcactttcgattttgaatgtggttctaccaccaacaacgtcgaacgc
caaaaacaggcggctttctctgacactattttcgtggtcggtacgcgcctgttgaccaaa
aagggtggcgatatcaaagattttgccaacctgaaagacaaagccgtagtcgtcacttcc
ggcactacctctgaagttttgctcaacaaactgaatgaagagcaaaaaatgaatatgcgc
atcatcagcgccaaagatcacggtgactctttccgcaccctggaaagcggtcgtgccgtt
gcctttatgatggatgacgctctgctggccggtgaacgtgcgaaagcgaagaaaccagac
aactgggaaatcgtcggcaagccgcagtctcaggaggcctacggttgtatgttgcgtaaa
gatgatccgcagttcaaaaagctgatggatgacaccatcgctcaggtgcagacctccggt
gaagcggaaaaatggtttgataagtggttcaaaaatccaattccgccgaaaaacctgaac
atgaatttcgaactgtcagacgaaatgaaagcactgttcaaagaaccgaatgacaaggca
ctgaactaa

DBGET integrated database retrieval system