KEGG   Escherichia coli K-12 MG1655: b0662Help
Entry
b0662             CDS       T00007                                 

Gene name
ubiF
Definition
(RefSeq) 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol oxygenase
  KO
K03184  2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase [EC:1.14.13.-]
Organism
eco  Escherichia coli K-12 MG1655
Pathway
eco00130  Ubiquinone and other terpenoid-quinone biosynthesis
eco01100  Metabolic pathways
eco01110  Biosynthesis of secondary metabolites
Module
eco_M00117  Ubiquinone biosynthesis, prokaryotes, chorismate => ubiquinone
Brite
KEGG Orthology (KO) [BR:eco00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00130 Ubiquinone and other terpenoid-quinone biosynthesis
    b0662 (ubiF)
Enzymes [BR:eco01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.13  With NADH or NADPH as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.13.-  
     b0662 (ubiF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAD_binding_3 SE Lycopene_cycl Trp_halogenase Pyr_redox_2 DAO NAD_binding_8 F420_oxidored 3HCDH_N Pyr_redox NAD_binding_9 ApbA UDPG_MGDP_dh_N TrkA_N FAD_binding_2 NAD_Gly3P_dh_N
Motif
Other DBs
NCBI-GeneID: 945261
NCBI-ProteinID: NP_415195
Pasteur: yleB
RegulonDB: ECK120002972
ECOCYC: G6365
ASAP: ABE-0002265
UniProt: P75728
Position
695101..696276
Genome map
AA seq 391 aa AA seqDB search
MTNQPTEIAIVGGGMVGGALALGLAQHGFAVTVIEHAEPAPFVADSQPDVRISAISAASV
SLLKGLGVWDAVQAMRCHPYRRLETWEWETAHVVFDAAELKLPLLGYMVENTVLQQALWQ
ALEAHPKVTLRVPGSLIALHRHDDLQELELKGGEVIRAKLVIGADGANSQVRQMAGIGVH
AWQYAQSCMLISVQCENDPGDSTWQQFTPDGPRAFLPLFDNWASLVWYDSPARIRQLQNM
NMAQLQAEIAKHFPSRLGYVTPLAAGAFPLTRRHALQYVQPGLALVGDAAHTIHPLAGQG
VNLGYRDVDALIDVLVNARSYGEAWASYPVLKRYQMRRMADNFIMQSGMDLFYAGFSNNL
PPLRFMRNLGLMAAERAGVLKRQALKYALGL
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
atgacaaatcaaccaacggaaattgccattgtcggcggaggaatggtcggcggcgcactg
gcgctggggctggcacagcacggatttgcggtaacggtgatcgagcacgcagaaccagcg
ccgtttgtcgctgatagccaaccggacgtgcggatctcggcgatcagcgcggcttcggta
tcattgcttaaagggttaggggtctgggatgcagtacaggctatgcgttgccatccttac
cgcagactggaaacgtgggagtgggaaacggcgcatgtggtgtttgacgccgctgaactt
aagctaccgctgcttggctatatggtggaaaacactgtcctgcaacaggcgttgtggcag
gcgctggaagcgcatccgaaagtaacgttacgtgtgccaggctcgctgattgcgctgcat
cgccatgatgatcttcaggagctggagctgaaaggcggtgaagtgattcgcgcgaagctg
gtgattggtgccgacggcgcaaattcgcaggtgcggcagatggcgggaattggcgttcat
gcatggcagtatgcgcagtcgtgcatgttgattagcgtccagtgcgagaacgatcccggc
gacagcacctggcagcaatttactccggacggaccgcgtgcgtttctgccgttgtttgat
aactgggcatcgctggtgtggtatgactctccggcgcgtattcgccagttgcagaatatg
aatatggcacagctccaggcggaaatcgcgaagcatttcccgtcgcgtctgggttacgtt
acaccgcttgccgctggtgcgtttccgctgacgcgtcgccatgcgttgcagtacgtgcag
ccagggcttgcgctggtgggcgatgccgcgcataccatccatccgctggcggggcaggga
gtgaatcttggttatcgtgatgtcgatgccctgattgatgttctggtcaacgcccgcagc
tacggcgaagcgtgggccagttatcctgtcctcaagcgttaccagatgcggcgcatggcg
gataacttcattatgcaaagcggtatggatctgttttatgccggattcagcaataatctg
ccaccactgcgttttatgcgtaatctcgggttaatggcggcggagcgtgctggcgtgttg
aaacgtcaggcgctgaaatatgcgttagggttgtag

DBGET integrated database retrieval system