KEGG   Escherichia coli K-12 MG1655: b0696Help
Entry
b0696             CDS       T00007                                 

Gene name
kdpC
Definition
(RefSeq) K(+) transporting P-type ATPase subunit KdpC
  KO
K01548  K+-transporting ATPase ATPase C chain [EC:3.6.3.12]
Organism
eco  Escherichia coli K-12 MG1655
Pathway
eco02020  Two-component system
Brite
KEGG Orthology (KO) [BR:eco00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    b0696 (kdpC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: KdpC
Motif
Other DBs
NCBI-GeneID: 947508
NCBI-ProteinID: NP_415224
Pasteur: kdpC
RegulonDB: ECK120000508
ECOCYC: EG10515
ASAP: ABE-0002374
UniProt: P03961 A0A387CYW2
Structure
PDB: 

Position
complement(724407..724979)
Genome map
AA seq 190 aa AA seqDB search
MSGLRPALSTFIFLLLITGGVYPLLTTVLGQWWFPWQANGSLIREGDTVRGSALIGQNFT
GNGYFHGRPSATAEMPYNPQASGGSNLAVSNPELDKLIAARVAALRAANPDASASVPVEL
VTASASGLDNNITPQAAAWQIPRVAKARNLSVEQLTQLIAKYSQQPLVKYIGQPVVNIVE
LNLALDKLDE
NT seq 573 nt NT seq  +upstreamnt  +downstreamnt
atgagtggattacgtccggcattatcaacatttatctttctgttattgattactggcggc
gtttacccgctgctgaccaccgtactggggcaatggtggtttccctggcaggccaatggt
tcgttgattcgtgaaggtgatacggtgcgcggttcggcattaatcgggcagaattttacc
ggcaacggctattttcatggtcgcccgtcggcaacggcagaaatgccctataatccacag
gcttctggcgggagcaatctggcggtcagtaaccctgagctggataaactaatagccgca
cgcgttgctgcattacgggccgctaacccggatgccagcgcgagcgttccggttgaactg
gtgacggcatcggcaagcgggctggacaataatatcaccccgcaagcggcggcctggcaa
atcccacgcgtggcgaaagcgcgtaatctcagcgttgaacagctcacgcaactgatcgca
aaatacagccaacaaccgctggtgaaatatatcggccagccggttgtcaacattgttgaa
ctcaatctggcgctggataaacttgatgaataa

DBGET integrated database retrieval system