KEGG   Escherichia coli K-12 MG1655: b0730Help
Entry
b0730             CDS       T00007                                 

Gene name
mngR
Definition
(RefSeq) DNA-binding transcriptional repressor MngR
  KO
K11922  GntR family transcriptional regulator, mannosyl-D-glycerate transport/metabolism system repressor
Organism
eco  Escherichia coli K-12 MG1655
Brite
KEGG Orthology (KO) [BR:eco00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:eco03000]
    b0730 (mngR)
Transcription factors [BR:eco03000]
 Prokaryotic Type
  Helix-turn-helix
   GntR family
    b0730 (mngR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: UTRA GntR HTH_DeoR HTH_11 Rrf2 HTH_41 HTH_Crp_2 PreAtp-grasp
Motif
Other DBs
NCBI-GeneID: 945371
NCBI-ProteinID: NP_415258
Pasteur: farR
RegulonDB: ECK120001095
ECOCYC: EG11109
ASAP: ABE-0002487
UniProt: P13669 A0A387CU29
Position
complement(765153..765875)
Genome map
AA seq 240 aa AA seqDB search
MGHKPLYRQIADRIREQIARGELKPGDALPTESALQTEFGVSRVTVRQALRQLVEQQILE
SIQGSGTYVKEERVNYDIFQLTSFDEKLSDRHVDTHSEVLIFEVIPADDFLQQQLQITPQ
DRVWHVKRVRYRKQKPMALEETWMPLALFPDLTWQVMENSKYHFIEEVKKMVIDRSEQEI
IPLMPTEEMSRLLNISQTKPILEKVSRGYLVDGRVFEYSRNAFNTDDYKFTLIAQRKSSR
NT seq 723 nt NT seq  +upstreamnt  +downstreamnt
atgggacacaagcccttataccggcagattgccgatcgcattcgtgaacaaattgcgcgt
ggcgagcttaaacctggcgatgcgttacccactgaatcagcgctacaaacagagtttggc
gtcagccgggttacggtgcgtcaggctttgcgccagctagtcgagcagcagatcctcgaa
agcattcagggcagcgggacttacgtcaaagaagagcgggtcaattacgatatttttcag
ttaaccagttttgatgaaaaactgtcggaccgtcacgtcgatacacacagtgaagttctg
atattcgaagtgattccggctgacgattttcttcagcaacagctacaaatcaccccgcag
gatcgtgtgtggcatgtgaagcgcgtgcgctatcgcaagcaaaagccaatggcgctggaa
gaaacctggatgccgcttgcgttgttcccggatctcacctggcaggtcatggaaaattcg
aaatatcactttatcgaagaagtgaagaaaatggttatcgatcgtagcgaacaggaaatc
attcctctgatgccaaccgaagagatgagccgtctgcttaatatcagccagacaaagccg
attcttgaaaaagtatcgcgtggatatttagttgatggtcgggtgtttgaatatagccgc
aacgcttttaataccgatgactataaatttaccctgatagcgcagcgaaaatcatcgcga
taa

DBGET integrated database retrieval system