KEGG   Escherichia coli K-12 MG1655: b0759Help
Entry
b0759             CDS       T00007                                 

Gene name
galE
Definition
(RefSeq) UDP-glucose 4-epimerase
  KO
K01784  UDP-glucose 4-epimerase [EC:5.1.3.2]
Organism
eco  Escherichia coli K-12 MG1655
Pathway
eco00052  Galactose metabolism
eco00520  Amino sugar and nucleotide sugar metabolism
eco01100  Metabolic pathways
Module
eco_M00632  Galactose degradation, Leloir pathway, galactose => alpha-D-glucose-1P
Brite
KEGG Orthology (KO) [BR:eco00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    b0759 (galE)
   00520 Amino sugar and nucleotide sugar metabolism
    b0759 (galE)
Enzymes [BR:eco01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.2  UDP-glucose 4-epimerase
     b0759 (galE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GDP_Man_Dehyd Epimerase 3Beta_HSD Polysacc_synt_2 RmlD_sub_bind NmrA NAD_binding_10 KR NAD_binding_4 adh_short UDPG_MGDP_dh_N adh_short_C2
Motif
Other DBs
NCBI-GeneID: 945354
NCBI-ProteinID: NP_415280
Pasteur: galE
RegulonDB: ECK120000355
ECOCYC: EG10362
ASAP: ABE-0002575
UniProt: P09147
Structure
PDB: 

Position
complement(791039..792055)
Genome map
AA seq 338 aa AA seqDB search
MRVLVTGGSGYIGSHTCVQLLQNGHDVIILDNLCNSKRSVLPVIERLGGKHPTFVEGDIR
NEALMTEILHDHAIDTVIHFAGLKAVGESVQKPLEYYDNNVNGTLRLISAMRAANVKNFI
FSSSATVYGDQPKIPYVESFPTGTPQSPYGKSKLMVEQILTDLQKAQPDWSIALLRYFNP
VGAHPSGDMGEDPQGIPNNLMPYIAQVAVGRRDSLAIFGNDYPTEDGTGVRDYIHVMDLA
DGHVVAMEKLANKPGVHIYNLGAGVGNSVLDVVNAFSKACGKPVNYHFAPRREGDLPAYW
ADASKADRELNWRVTRTLDEMAQDTWHWQSRHPQGYPD
NT seq 1017 nt NT seq  +upstreamnt  +downstreamnt
atgagagttctggttaccggtggtagcggttacattggaagtcatacctgtgtgcaatta
ctgcaaaacggtcatgatgtcatcattcttgataacctctgtaacagtaagcgcagcgta
ctgcctgttatcgagcgtttaggcggcaaacatccaacgtttgttgaaggcgatattcgt
aacgaagcgttgatgaccgagatcctgcacgatcacgctatcgacaccgtgatccacttc
gccgggctgaaagccgtgggcgaatcggtacaaaaaccgctggaatattacgacaacaat
gtcaacggcactctgcgcctgattagcgccatgcgcgccgctaacgtcaaaaactttatt
tttagctcctccgccaccgtttatggcgatcagcccaaaattccatacgttgaaagcttc
ccgaccggcacaccgcaaagcccttacggcaaaagcaagctgatggtggaacagatcctc
accgatctgcaaaaagcccagccggactggagcattgccctgctgcgctacttcaacccg
gttggcgcgcatccgtcgggcgatatgggcgaagatccgcaaggcattccgaataacctg
atgccatacatcgcccaggttgctgtaggccgtcgcgactcgctggcgatttttggtaac
gattatccgaccgaagatggtactggcgtacgcgattacatccacgtaatggatctggcg
gacggtcacgtcgtggcgatggaaaaactggcgaacaagccaggcgtacacatctacaac
ctcggcgctggcgtaggcaacagcgtgctggacgtggttaatgccttcagcaaagcctgc
ggcaaaccggttaattatcattttgcaccgcgtcgcgagggcgaccttccggcctactgg
gcggacgccagcaaagccgaccgtgaactgaactggcgcgtaacgcgcacactcgatgaa
atggcgcaggacacctggcactggcagtcacgccatccacagggatatcccgattaa

DBGET integrated database retrieval system