KEGG   Escherichia coli K-12 MG1655: b0782
Entry
b0782             CDS       T00007                                 

Gene name
moaB
Definition
(RefSeq) MoaB protein
  KO
K03638  molybdopterin adenylyltransferase [EC:2.7.7.75]
Organism
eco  Escherichia coli K-12 MG1655
Pathway
eco00790  Folate biosynthesis
eco01100  Metabolic pathways
eco01240  Biosynthesis of cofactors
eco04122  Sulfur relay system
Module
eco_M00880  Molybdenum cofactor biosynthesis, GTP => molybdenum cofactor
Brite
KEGG Orthology (KO) [BR:eco00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    b0782 (moaB)
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04122 Sulfur relay system
    b0782 (moaB)
Enzymes [BR:eco01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.75  molybdopterin adenylyltransferase
     b0782 (moaB)
SSDB
Motif
Pfam: MoCF_biosynth
Other DBs
NCBI-GeneID: 945396
NCBI-ProteinID: NP_415303
Pasteur: moaB
RegulonDB: ECK120001544
ECOCYC: EG11596
ASAP: ABE-0002671
UniProt: P0AEZ9
Structure
PDB: 
1MKZ 1R2K

Position
818055..818567
AA seq 170 aa
MSQVSTEFIPTRIAILTVSNRRGEEDDTSGHYLRDSAQEAGHHVVDKAIVKENRYAIRAQ
VSAWIASDDVQVVLITGGTGLTEGDQAPEALLPLFDREVEGFGEVFRMLSFEEIGTSTLQ
SRAVAGVANKTLIFAMPGSTKACRTAWENIIAPQLDARTRPCNFHPHLKK
NT seq 513 nt   +upstreamnt  +downstreamnt
atgagtcaggtaagcactgaatttatcccgacccgtattgctattcttacggtttctaat
cgtcgcggtgaagaagacgatacctccggtcactatctgcgcgattcggcgcaagaagcg
ggccatcacgttgtcgataaagccattgtgaaagaaaaccgctacgctattcgcgctcag
gtatctgcgtggatcgccagcgacgatgtacaagtggtattgattacgggtggtactggc
ctgacggaaggtgatcaggctcccgaagcattgctgccgttgttcgaccgtgaagttgaa
ggttttggtgaagtgttccggatgttgtcgtttgaagagattggcacttccacgttgcaa
tctcgtgcggtagcgggcgtcgccaacaaaacgctgattttcgccatgccgggttcgacc
aaagcgtgccgtaccgcatgggaaaatatcatcgcgccgcagctggatgcccgtacgcgt
ccgtgtaatttccatccacatttgaagaaataa

DBGET integrated database retrieval system